Maxine's Burn Maxine’s is Australian Made & Australian Owned Quality Supplements. Protein, Bars, Fat Burning, Weight Loss. Browse the Selection Today. 39409904648292 4795266400356burn20serves500gcookiescream Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 44.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Cookies & Cream 39409904975972 4795266400356burn20serves500gicedmochaccino Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 44.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Iced Mochaccino 32500489388132 4795266400356burn20serves500gchocfudgebrownie Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 44.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie 32500489453668 4795266400356burn20serves500gvanillaicecream Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 44.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream 32500489486436 4795266400356burn20serves500gchochoneycomb Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 44.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb 32500489519204 4795266400356burn20serves500gsaltedcaramel Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 44.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel 32500489420900 4795266400356burn20serves500gberrycheesecake Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 44.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake 39409905139812 4795266400356burn50serves125kgcookiescream Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 89.95 AUD 79.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Cookies & Cream 39409904812132 4795266400356burn50serves125kgicedmochaccino Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 89.95 AUD 79.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Iced Mochaccino 32500489551972 4795266400356burn50serves125kgchocfudgebrownie Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 89.95 AUD 79.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie 32500489617508 4795266400356burn50serves125kgvanillaicecream Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 89.95 AUD 79.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream 32500489650276 4795266400356burn50serves125kgchochoneycomb Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 89.95 AUD 79.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb 32500489683044 4795266400356burn50serves125kgsaltedcaramel Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 89.95 AUD 79.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel 32500489584740 4795266400356burn50serves125kgberrycheesecake Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 89.95 AUD 79.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake 32605988225124 4795266400356burn90serves22kgchocfudgebrownie Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 134.95 AUD 124.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Choc Fudge Brownie 32605988388964 4795266400356burn90serves22kgvanillaicecream Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 134.95 AUD 124.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Vanilla Ice Cream 33061980831844 4795266400356burn90serves22kgchochoneycomb Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 134.95 AUD 124.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Choc Honeycomb 33061980864612 4795266400356burn90serves22kgsaltedcaramel Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 134.95 AUD 124.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Salted Caramel 33061980569700 4795266400356burn90serves22kgcookiescream Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 134.95 AUD 124.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Cookies & Cream 39409918443620 4795266400356burn90serves22kgicedmochaccino Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 134.95 AUD 124.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Iced Mochaccino 39413716222052 4795266400356burn90serves22kgberrycheesecake Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 134.95 AUD 124.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Berry Cheesecake 32500491190372 4795266531428night20serves500gchocolatemousse Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 42.95 AUD 37.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse 32500491223140 4795266531428night20serves500gvanilladream Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 42.95 AUD 37.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream 32500491255908 4795266531428night40serves1kgchocolatemousse Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 74.95 AUD 69.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse 32500491288676 4795266531428night40serves1kgvanilladream Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 74.95 AUD 69.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream 39323044610148 4795266531428night20serves500gsaltedcaramel Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 42.95 AUD 37.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel 39323044642916 4795266531428night40serves1kgsaltedcaramel Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 74.95 AUD 69.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Salted Caramel 32868512039012 4832130760804burnbarsboxof12choccaramelcrunch Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Caramel Crunch 32868512137316 4832130760804burnbarsboxof12chocmocha Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Mocha 32868512071780 4832130760804burnbarsboxof12doublechocfudge Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Double Choc Fudge 32868512104548 4832130760804burnbarsboxof12cookiescream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Cookies & Cream 32868512170084 4832130760804burnbarsboxof12chocmintfudge Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Mint Fudge 32868512006244 4832130760804burnbarsboxof12coconutdream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Coconut Dream 32868511973476 4832130760804burnbarsboxof12hazelnutheaven Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Hazelnut Heaven 32868512202852 4832130760804burnbarsboxof12redvelvetcupcake Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Red Velvet Cupcake 32868512235620 4832130760804burnbarsboxof12whitechocraspberry Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 White Choc Raspberry 32868512268388 4832130760804burnbarsboxof12mangococonutcream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Mango Coconut Cream 32868512301156 4832130760804burnbarsboxof12berrydelight Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Berry Delight 32868512333924 4832130760804burnbarsindividualbarchoccaramelcrunch Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Caramel Crunch 32868512432228 4832130760804burnbarsindividualbarchocmocha Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Mocha 32868512366692 4832130760804burnbarsindividualbardoublechocfudge Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Double Choc Fudge 32868512399460 4832130760804burnbarsindividualbarcookiescream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Cookies & Cream 32868512464996 4832130760804burnbarsindividualbarchocmintfudge Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Mint Fudge 32868512628836 4832130760804burnbarsindividualbarcoconutdream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Coconut Dream 32868512661604 4832130760804burnbarsindividualbarhazelnutheaven Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Hazelnut Heaven 32868512497764 4832130760804burnbarsindividualbarredvelvetcupcake Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Red Velvet Cupcake 32868512530532 4832130760804burnbarsindividualbarwhitechocraspberry Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar White Choc Raspberry 32868512563300 4832130760804burnbarsindividualbarmangococonutcream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Mango Coconut Cream 32868512596068 4832130760804burnbarsindividualbarberrydelight Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Berry Delight 32500532805732 4795267219556burncookiesboxof12chocolate Maxine's BURN Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Chocolate 32500532838500 4795267219556burncookiesboxof12cookiesncream Maxine's BURN Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 39.95 AUD 35.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Cookies 'N Cream 32500532740196 4795267219556burncookiesindividualcookiechocolate Maxine's BURN Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Chocolate 32500532772964 4795267219556burncookiesindividualcookiecookiesncream Maxine's BURN Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 3.95 AUD 3.50 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Cookies 'N Cream 32880069279844 4836907876452sipnburn30serves300gfruityfrost Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 49.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Fruity Frost 32880069312612 4836907876452sipnburn30serves300ggoinggrape Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 49.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Going Grape 32880069345380 4836907909220creaburn30serves300gcolacrush Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 54.95 AUD 44.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Cola Crush 32880069378148 4836907909220creaburn30serves300ggrapesplash Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 54.95 AUD 44.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Grape Splash 4864133693540 vibrantMaxine's VIBRANT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock49.95 AUD 39.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Workout Performance 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4836908007524 cla-conjugated-linoleic-acidMaxine's CLA - Conjugated Linoleic Acid Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock39.95 AUD 29.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Fat Burners 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 32943463465060 4820381007972maxinesbeginnerburnpackchocfudgebrowniechocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse 32943463596132 4820381007972maxinesbeginnerburnpackchocfudgebrownievanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream 40247901225060 4820381007972maxinesbeginnerburnpackchocfudgebrowniesaltedcaramel Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Salted Caramel 32943463727204 4820381007972maxinesbeginnerburnpackvanillaicecreamchocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse 32943463858276 4820381007972maxinesbeginnerburnpackvanillaicecreamvanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream 40247901257828 4820381007972maxinesbeginnerburnpackvanillaicecreamsaltedcaramel Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Salted Caramel 32943463989348 4820381007972maxinesbeginnerburnpackchocolatehoneycombchocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse 32943464120420 4820381007972maxinesbeginnerburnpackchocolatehoneycombvanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream 40247901290596 4820381007972maxinesbeginnerburnpackchocolatehoneycombsaltedcaramel Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Salted Caramel 32943464251492 4820381007972maxinesbeginnerburnpacksaltedcaramelchocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse 32943464382564 4820381007972maxinesbeginnerburnpacksaltedcaramelvanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream 40247901323364 4820381007972maxinesbeginnerburnpacksaltedcaramelsaltedcaramel Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Salted Caramel 32943464513636 4820381007972maxinesbeginnerburnpackberrycheesecakechocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse 32943464644708 4820381007972maxinesbeginnerburnpackberrycheesecakevanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream 40247901356132 4820381007972maxinesbeginnerburnpackberrycheesecakesaltedcaramel Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Salted Caramel 40248008179812 4820381007972maxinesbeginnerburnpackicedmochaccinochocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Chocolate Mousse 40248008212580 4820381007972maxinesbeginnerburnpackicedmochaccinovanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Vanilla Dream 40248008245348 4820381007972maxinesbeginnerburnpackicedmochaccinosaltedcaramel Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 88.40 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Salted Caramel 32943516123236 4820382285924intermediateburnpackchocfudgebrowniechocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Fruity Frost 32943516156004 4820382285924intermediateburnpackchocfudgebrowniechocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Going Grape 32943516188772 4820382285924intermediateburnpackchocfudgebrownievanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Fruity Frost 32943516221540 4820382285924intermediateburnpackchocfudgebrownievanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Going Grape 32943516254308 4820382285924intermediateburnpackvanillaicecreamchocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Fruity Frost 32943516287076 4820382285924intermediateburnpackvanillaicecreamchocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Going Grape 32943516319844 4820382285924intermediateburnpackvanillaicecreamvanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Fruity Frost 32943516352612 4820382285924intermediateburnpackvanillaicecreamvanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Going Grape 32943516385380 4820382285924intermediateburnpackchocolatehoneycombchocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse Fruity Frost 32943516418148 4820382285924intermediateburnpackchocolatehoneycombchocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse Going Grape 32943516450916 4820382285924intermediateburnpackchocolatehoneycombvanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream Fruity Frost 32943516483684 4820382285924intermediateburnpackchocolatehoneycombvanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream Going Grape 32943516516452 4820382285924intermediateburnpacksaltedcaramelchocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse Fruity Frost 32943516549220 4820382285924intermediateburnpacksaltedcaramelchocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse Going Grape 32943516581988 4820382285924intermediateburnpacksaltedcaramelvanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream Fruity Frost 32943516614756 4820382285924intermediateburnpacksaltedcaramelvanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream Going Grape 32943516647524 4820382285924intermediateburnpackberrycheesecakechocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse Fruity Frost 32943516680292 4820382285924intermediateburnpackberrycheesecakechocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse Going Grape 32943516713060 4820382285924intermediateburnpackberrycheesecakevanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream Fruity Frost 32943516745828 4820382285924intermediateburnpackberrycheesecakevanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 215.90 AUD 185.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream Going Grape 32943555477604 4820382351460advancedburnpackchocfudgebrowniechocolatemoussefruityfrost Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 334.95 AUD 275.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Fruity Frost 32943555510372 4820382351460advancedburnpackchocfudgebrowniechocolatemoussegoinggrape Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 334.95 AUD 275.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Going Grape 32943555543140 4820382351460advancedburnpackchocfudgebrownievanilladreamfruityfrost Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 334.95 AUD 275.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Fruity Frost 32943555575908 4820382351460advancedburnpackchocfudgebrownievanilladreamgoinggrape Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 334.95 AUD 275.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Going Grape 32943555608676 4820382351460advancedburnpackvanillaicecreamchocolatemoussefruityfrost Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 334.95 AUD 275.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Fruity Frost 32943555641444 4820382351460advancedburnpackvanillaicecreamchocolatemoussegoinggrape Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 334.95 AUD 275.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Going Grape 32943555674212 4820382351460advancedburnpackvanillaicecreamvanilladreamfruityfrost Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 334.95 AUD 275.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Fruity Frost 32943555706980 4820382351460advancedburnpackvanillaicecreamvanilladreamgoinggrape Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 334.95 AUD 275.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Going Grape 32880246030436 4836918886500twinpackburnprotein20serves500gchocfudgebrowniechocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Choc Fudge Brownie 32880246063204 4836918886500twinpackburnprotein20serves500gchocfudgebrownieberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Berry Cheesecake 32880246095972 4836918886500twinpackburnprotein20serves500gchocfudgebrownievanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Vanilla Ice Cream 32880246128740 4836918886500twinpackburnprotein20serves500gchocfudgebrowniechochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Choc Honeycomb 32880246161508 4836918886500twinpackburnprotein20serves500gchocfudgebrowniesaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Salted Caramel 32880246194276 4836918886500twinpackburnprotein20serves500gberrycheesecakechocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Choc Fudge Brownie 32880246227044 4836918886500twinpackburnprotein20serves500gberrycheesecakeberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Berry Cheesecake 32880246259812 4836918886500twinpackburnprotein20serves500gberrycheesecakevanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Vanilla Ice Cream 32880246292580 4836918886500twinpackburnprotein20serves500gberrycheesecakechochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Choc Honeycomb 32880246325348 4836918886500twinpackburnprotein20serves500gberrycheesecakesaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Salted Caramel 32880246358116 4836918886500twinpackburnprotein20serves500gvanillaicecreamchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Choc Fudge Brownie 32880246390884 4836918886500twinpackburnprotein20serves500gvanillaicecreamberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Berry Cheesecake 32880246423652 4836918886500twinpackburnprotein20serves500gvanillaicecreamvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Vanilla Ice Cream 32880246456420 4836918886500twinpackburnprotein20serves500gvanillaicecreamchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Choc Honeycomb 32880246489188 4836918886500twinpackburnprotein20serves500gvanillaicecreamsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Salted Caramel 32880246521956 4836918886500twinpackburnprotein20serves500gchochoneycombchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Choc Fudge Brownie 32880246554724 4836918886500twinpackburnprotein20serves500gchochoneycombberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Berry Cheesecake 32880246587492 4836918886500twinpackburnprotein20serves500gchochoneycombvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Vanilla Ice Cream 32880246620260 4836918886500twinpackburnprotein20serves500gchochoneycombchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Choc Honeycomb 32880246653028 4836918886500twinpackburnprotein20serves500gchochoneycombsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Salted Caramel 32880246685796 4836918886500twinpackburnprotein20serves500gsaltedcaramelchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Choc Fudge Brownie 32880246718564 4836918886500twinpackburnprotein20serves500gsaltedcaramelberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Berry Cheesecake 32880246751332 4836918886500twinpackburnprotein20serves500gsaltedcaramelvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Vanilla Ice Cream 32880246784100 4836918886500twinpackburnprotein20serves500gsaltedcaramelchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Choc Honeycomb 32880246816868 4836918886500twinpackburnprotein20serves500gsaltedcaramelsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Salted Caramel 32880246849636 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniechocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Choc Fudge Brownie 32880246882404 4836918886500twinpackburnprotein50serves125kgchocfudgebrownieberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Berry Cheesecake 32880246915172 4836918886500twinpackburnprotein50serves125kgchocfudgebrownievanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Vanilla Ice Cream 32880246947940 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniechochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Choc Honeycomb 32880246980708 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniesaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Salted Caramel 32880247013476 4836918886500twinpackburnprotein50serves125kgberrycheesecakechocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Choc Fudge Brownie 32880247046244 4836918886500twinpackburnprotein50serves125kgberrycheesecakeberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Berry Cheesecake 32880247079012 4836918886500twinpackburnprotein50serves125kgberrycheesecakevanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Vanilla Ice Cream 32880247111780 4836918886500twinpackburnprotein50serves125kgberrycheesecakechochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Choc Honeycomb 32880247144548 4836918886500twinpackburnprotein50serves125kgberrycheesecakesaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Salted Caramel 32880247177316 4836918886500twinpackburnprotein50serves125kgvanillaicecreamchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Choc Fudge Brownie 32880247210084 4836918886500twinpackburnprotein50serves125kgvanillaicecreamberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Berry Cheesecake 32880247242852 4836918886500twinpackburnprotein50serves125kgvanillaicecreamvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Vanilla Ice Cream 32880247275620 4836918886500twinpackburnprotein50serves125kgvanillaicecreamchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Choc Honeycomb 32880247308388 4836918886500twinpackburnprotein50serves125kgvanillaicecreamsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Salted Caramel 32880247341156 4836918886500twinpackburnprotein50serves125kgchochoneycombchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Choc Fudge Brownie 32880247373924 4836918886500twinpackburnprotein50serves125kgchochoneycombberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Berry Cheesecake 32880247406692 4836918886500twinpackburnprotein50serves125kgchochoneycombvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Vanilla Ice Cream 32880247439460 4836918886500twinpackburnprotein50serves125kgchochoneycombchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Choc Honeycomb 32880247472228 4836918886500twinpackburnprotein50serves125kgchochoneycombsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Salted Caramel 32880247504996 4836918886500twinpackburnprotein50serves125kgsaltedcaramelchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Choc Fudge Brownie 32880247537764 4836918886500twinpackburnprotein50serves125kgsaltedcaramelberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Berry Cheesecake 32880247570532 4836918886500twinpackburnprotein50serves125kgsaltedcaramelvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Vanilla Ice Cream 32880247603300 4836918886500twinpackburnprotein50serves125kgsaltedcaramelchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Choc Honeycomb 32880247636068 4836918886500twinpackburnprotein50serves125kgsaltedcaramelsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 129.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Salted Caramel 32880256090212 4836918460516twinpacknightprotein20serves500gchocolatemoussechocolatemousse Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 74.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse Chocolate Mousse 32880256122980 4836918460516twinpacknightprotein20serves500gchocolatemoussevanilladream Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 74.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse Vanilla Dream 32880256155748 4836918460516twinpacknightprotein20serves500gvanilladreamchocolatemousse Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 74.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream Chocolate Mousse 32880256188516 4836918460516twinpacknightprotein20serves500gvanilladreamvanilladream Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 74.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream Vanilla Dream 32880256221284 4836918460516twinpacknightprotein40serves1kgchocolatemoussechocolatemousse Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 116.91 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse Chocolate Mousse 32880256254052 4836918460516twinpacknightprotein40serves1kgchocolatemoussevanilladream Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 116.91 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse Vanilla Dream 32880256286820 4836918460516twinpacknightprotein40serves1kgvanilladreamchocolatemousse Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 116.91 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream Chocolate Mousse 32880256319588 4836918460516twinpacknightprotein40serves1kgvanilladreamvanilladream Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 116.91 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream Vanilla Dream 32880265527396 4836919640164twinpackplantprotein16serves400gnaturalchocolatenaturalchocolate Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 79.95 AUD 62.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate Natural Chocolate 32880265560164 4836919640164twinpackplantprotein16serves400gnaturalchocolatevanillabean Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 79.95 AUD 62.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate Vanilla Bean 32880265592932 4836919640164twinpackplantprotein16serves400gvanillabeannaturalchocolate Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 79.95 AUD 62.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean Natural Chocolate 32880265625700 4836919640164twinpackplantprotein16serves400gvanillabeanvanillabean Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 79.95 AUD 62.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean Vanilla Bean 32880265658468 4836919640164twinpackplantprotein36serves908gnaturalchocolatenaturalchocolate Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 139.95 AUD 107.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate Natural Chocolate 32880265691236 4836919640164twinpackplantprotein36serves908gnaturalchocolatevanillabean Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 139.95 AUD 107.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate Vanilla Bean 32880265724004 4836919640164twinpackplantprotein36serves908gvanillabeannaturalchocolate Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 139.95 AUD 107.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean Natural Chocolate 32880265756772 4836919640164twinpackplantprotein36serves908gvanillabeanvanillabean Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 139.95 AUD 107.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean Vanilla Bean 4836920557668 twin-pack-burn-barsTwin Pack: Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock7.95 AUD 6.49 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Double Choc Fudge 4836920590436 twin-pack-burn-cookiesTwin Pack: Maxine's Burn Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New out_of_stock7.95 AUD 5.29 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate 32880269688932 4836919902308twinpacksipnburnfruityfrostfruityfrost Twin Pack: Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Fruity Frost Fruity Frost 32880269721700 4836919902308twinpacksipnburnfruityfrostgoinggrape Twin Pack: Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Fruity Frost Going Grape 32880269754468 4836919902308twinpacksipnburngoinggrapefruityfrost Twin Pack: Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Going Grape Fruity Frost 32880269787236 4836919902308twinpacksipnburngoinggrapegoinggrape Twin Pack: Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Going Grape Going Grape 32880274374756 4836920328292twinpackcreaburncolacrushcolacrush Twin Pack: Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.90 AUD 71.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cola Crush Cola Crush 32880274407524 4836920328292twinpackcreaburncolacrushgrapesplash Twin Pack: Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.90 AUD 71.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cola Crush Grape Splash 32880274440292 4836920328292twinpackcreaburngrapesplashcolacrush Twin Pack: Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.90 AUD 71.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Grape Splash Cola Crush 32880274473060 4836920328292twinpackcreaburngrapesplashgrapesplash Twin Pack: Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.90 AUD 71.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Grape Splash Grape Splash 4836920754276 twin-pack-cla-capsulesTwin Pack: Maxine's CLA Capsules Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock79.95 AUD 53.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4816552198244 maxines-premium-shakerMaxine's Premium Shaker Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock19.95 AUD 14.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4816000516196 pink-training-singletMaxine's Pink Training Singlet Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock34.95 AUD 29.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayXS 4816552132708 black-training-singletMaxine's Black Training Singlet Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock34.95 AUD 29.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayXS 4816552362084 maxines-training-t-shirtMaxine's Training T-Shirt Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock29.95 AUD 12.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay6 39295360729188 6539906187364burncustard16serves500gcreamyvanillagoodness Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 41.95 AUD 37.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Creamy Vanilla Goodness 39295360893028 6539906187364burncustard16serves500gwhippedchocolatedecadence Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 41.95 AUD 37.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Whipped Chocolate Decadence 39258441187428 6539906187364burncustard33serves1kgcreamyvanillagoodness Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 74.95 AUD 69.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Creamy Vanilla Goodness 39258441154660 6539906187364burncustard33serves1kgwhippedchocolatedecadence Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 74.95 AUD 69.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Whipped Chocolate Decadence 39265275281508 6542142636132twinpackburncustard16serves500gcreamyvanillagoodnesscreamyvanillagoodn Twin Pack: Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 65.95 AUD 62.91 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Creamy Vanilla Goodness Creamy Vanilla Goodness 39265275314276 6542142636132twinpackburncustard16serves500gcreamyvanillagoodnesswhippedchocolatede Twin Pack: Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 65.95 AUD 62.91 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Creamy Vanilla Goodness Whipped Chocolate Decadence 39265275347044 6542142636132twinpackburncustard16serves500gwhippedchocolatedecadencecreamyvanillag Twin Pack: Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 65.95 AUD 62.91 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Whipped Chocolate Decadence Creamy Vanilla Goodness 39265275379812 6542142636132twinpackburncustard16serves500gwhippedchocolatedecadencewhippedchocola Twin Pack: Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 65.95 AUD 62.91 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Whipped Chocolate Decadence Whipped Chocolate Decadence 39265275412580 6542142636132twinpackburncustard33serves1kgcreamyvanillagoodnesscreamyvanillagoodne Twin Pack: Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 107.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Creamy Vanilla Goodness Creamy Vanilla Goodness 39265275445348 6542142636132twinpackburncustard33serves1kgcreamyvanillagoodnesswhippedchocolatedec Twin Pack: Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 107.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Creamy Vanilla Goodness Whipped Chocolate Decadence 39265275478116 6542142636132twinpackburncustard33serves1kgwhippedchocolatedecadencecreamyvanillago Twin Pack: Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 107.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Whipped Chocolate Decadence Creamy Vanilla Goodness 39265275510884 6542142636132twinpackburncustard33serves1kgwhippedchocolatedecadencewhippedchocolat Twin Pack: Maxine's BURN Custard Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 107.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Whipped Chocolate Decadence Whipped Chocolate Decadence 6546036850788 maxines-workout-bottleMaxine's Workout Bottle Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock24.95 AUD 19.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 39399258980452 6591963988068betterbiome40serves300gberrybliss Maxine's Better Biome Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 74.95 AUD 64.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Health & Lifestyle > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (300g) Berry Bliss 6647341842532 mct-capsulesMaxine's MCT Capsules Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock39.95 AUD 29.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 39837949001828 6731456184420melt60serves300gmouthwateringmelon Maxine's Melt Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 69.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Fat Burners > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay60 Serves (300g) Mouth Watering Melon 39837949132900 6731456184420melt60serves300gnonstimkiwilimecrush Maxine's Melt Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 69.95 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD Fat Burners > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay60 Serves (300g) (NON STIM) Kiwi Lime Crush 40247984095332 6860030640228burncustarddessertpackmchallengevanillaicecreamcreamyvanillagoodness10 Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247984193636 6860030640228burncustarddessertpackmchallengevanillaicecreamwhippedchocolatedecaden Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Whipped Chocolate Decadence 100 Serves (100 Capsules) 40247983603812 6860030640228burncustarddessertpackmchallengechocfudgebrowniecreamyvanillagoodness1 Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247983702116 6860030640228burncustarddessertpackmchallengechocfudgebrowniewhippedchocolatedecade Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Whipped Chocolate Decadence 100 Serves (100 Capsules) 40248033804388 6860030640228burncustarddessertpackmchallengeberrycheesecakecreamyvanillagoodness10 Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Creamy Vanilla Goodness 100 Serves (100 Capsules) 40248033837156 6860030640228burncustarddessertpackmchallengeberrycheesecakewhippedchocolatedecaden Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Whipped Chocolate Decadence 100 Serves (100 Capsules) 40247984619620 6860030640228burncustarddessertpackmchallengechochoneycombcreamyvanillagoodness100s Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Honeycomb Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247984717924 6860030640228burncustarddessertpackmchallengechochoneycombwhippedchocolatedecadence Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Honeycomb Whipped Chocolate Decadence 100 Serves (100 Capsules) 40247983112292 6860030640228burncustarddessertpackmchallengecookiescreamcreamyvanillagoodness100se Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cookies & Cream Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247983210596 6860030640228burncustarddessertpackmchallengecookiescreamwhippedchocolatedecadence1 Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cookies & Cream Whipped Chocolate Decadence 100 Serves (100 Capsules) 40247982620772 6860030640228burncustarddessertpackmchallengeicedmochaccinocreamyvanillagoodness100 Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247982719076 6860030640228burncustarddessertpackmchallengeicedmochaccinowhippedchocolatedecadenc Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Whipped Chocolate Decadence 100 Serves (100 Capsules) 40248052351076 6860030640228burncustarddessertpackmchallengesaltedcaramelcreamyvanillagoodness100s Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Creamy Vanilla Goodness 100 Serves (100 Capsules) 40248052383844 6860030640228burncustarddessertpackmchallengesaltedcaramelwhippedchocolatedecadence Maxine's Burn & Custard Dessert Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 107.85 AUD 77.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Whipped Chocolate Decadence 100 Serves (100 Capsules) 40248085282916 6860068454500meltburnvaluepackmchallengevanillaicecreammouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Mouthwatering Melon 25 Serves 40248085315684 6860068454500meltburnvaluepackmchallengevanillaicecreamkiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Kiwi Lime Crush (NON STIM) 25 Serves 40248085348452 6860068454500meltburnvaluepackmchallengechocfudgebrowniemouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Mouthwatering Melon 25 Serves 40248085381220 6860068454500meltburnvaluepackmchallengechocfudgebrowniekiwilimecrushnonstim25serve Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Kiwi Lime Crush (NON STIM) 25 Serves 40248085413988 6860068454500meltburnvaluepackmchallengeberrycheesecakemouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Mouthwatering Melon 25 Serves 40248085446756 6860068454500meltburnvaluepackmchallengeberrycheesecakekiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Kiwi Lime Crush (NON STIM) 25 Serves 40248085479524 6860068454500meltburnvaluepackmchallengechochoneycombmouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Honeycomb Mouthwatering Melon 25 Serves 40248085512292 6860068454500meltburnvaluepackmchallengechochoneycombkiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Honeycomb Kiwi Lime Crush (NON STIM) 25 Serves 40248085545060 6860068454500meltburnvaluepackmchallengecookiescreammouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cookies & Cream Mouthwatering Melon 25 Serves 40248085577828 6860068454500meltburnvaluepackmchallengecookiescreamkiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cookies & Cream Kiwi Lime Crush (NON STIM) 25 Serves 40248085610596 6860068454500meltburnvaluepackmchallengeicedmochaccinomouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Mouthwatering Melon 25 Serves 40248085643364 6860068454500meltburnvaluepackmchallengeicedmochaccinokiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Kiwi Lime Crush (NON STIM) 25 Serves 40248085676132 6860068454500meltburnvaluepackmchallengesaltedcaramelmouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Mouthwatering Melon 25 Serves 40248085708900 6860068454500meltburnvaluepackmchallengesaltedcaramelkiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 184.85 AUD 144.90 AUD 2022-06-29T14:49:52+1000/2022-07-29T14:49:52+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Kiwi Lime Crush (NON STIM) 25 Serves