Maxine's Burn https://maxinesburn.com Maxine’s is Australian Made & Australian Owned Quality Supplements. Protein, Bars, Fat Burning, Weight Loss. 32500489388132 4795266400356burn20serves500gchocfudgebrownie Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489388132https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Choc-Fudge-Brownie.png?v=1596764560Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500489420900 4795266400356burn20serves500gberrycheesecake Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489420900https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Berry-Cheesecake.png?v=1596764560Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500489453668 4795266400356burn20serves500gvanillaicecream Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489453668https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Vanilla-Ice-Cream.png?v=1596764560Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500489486436 4795266400356burn20serves500gchochoneycomb Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489486436https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Choc-Honeycomb.png?v=1596764560Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500489519204 4795266400356burn20serves500gsaltedcaramel Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489519204https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Salted-Caramel_602a3844-06da-4fc4-843f-cd1823e195cb.png?v=1596764560Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500489551972 4795266400356burn50serves125kgchocfudgebrownie Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489551972https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Choc-Fudge-Brownie.png?v=1596764560Maxine's New in_stock 69.95 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500489584740 4795266400356burn50serves125kgberrycheesecake Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489584740https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Berry-Cheesecake.png?v=1596764560Maxine's New in_stock 69.95 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500489617508 4795266400356burn50serves125kgvanillaicecream Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489617508https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Vanilla-Ice-Cream.png?v=1596764560Maxine's New in_stock 69.95 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500489650276 4795266400356burn50serves125kgchochoneycomb Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489650276https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Chocolate-Honeycomb.png?v=1596764560Maxine's New in_stock 69.95 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500489683044 4795266400356burn50serves125kgsaltedcaramel Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32500489683044https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Salted-Caramel.png?v=1596764560Maxine's New in_stock 69.95 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32605988225124 4795266400356burn90serves22kgchocfudgebrownie Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32605988225124https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Choc-Fudge-Brownie.png?v=1596764560Maxine's New in_stock 109.95 AUD 99.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Choc Fudge Brownie https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32605988388964 4795266400356burn90serves22kgvanillaicecream Maxine's BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn?variant=32605988388964https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Choc-Fudge-Brownie.png?v=1596764560Maxine's New in_stock 109.95 AUD 99.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Vanilla Ice Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560 32500491190372 4795266531428night20serves500gchocolatemousse Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/night?variant=32500491190372https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night_Choc_500g.png?v=1596764651Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse 32500491223140 4795266531428night20serves500gvanilladream Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/night?variant=32500491223140https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night_Vanilla_500g.png?v=1596764651Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream 32500491255908 4795266531428night40serves1kgchocolatemousse Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/night?variant=32500491255908https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night_Choc_1kg.png?v=1596764677Maxine's New in_stock 59.95 AUD 49.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse 32500491288676 4795266531428night40serves1kgvanilladream Maxine's NIGHT Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/night?variant=32500491288676https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night_Vanilla_1kg.png?v=1596764692Maxine's New in_stock 59.95 AUD 49.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream 32500550140004 4795266596964plantprotein16serves400gnaturalchocolate Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/plant-protein?variant=32500550140004https://cdn.shopify.com/s/files/1/0270/2917/6420/products/plantproteinnaturalchoc-400g.png?v=1596765359Maxine's New in_stock 39.95 AUD 34.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate https://cdn.shopify.com/s/files/1/0270/2917/6420/products/plantproteinback.png?v=1596765459 32500550172772 4795266596964plantprotein16serves400gvanillabean Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/plant-protein?variant=32500550172772https://cdn.shopify.com/s/files/1/0270/2917/6420/products/plant_protein_creamy_vanilla_-_400g.png?v=1596765459Maxine's New out_of_stock 39.95 AUD 34.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean https://cdn.shopify.com/s/files/1/0270/2917/6420/products/plantproteinback.png?v=1596765459 32500550205540 4795266596964plantprotein36serves908gnaturalchocolate Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/plant-protein?variant=32500550205540https://cdn.shopify.com/s/files/1/0270/2917/6420/products/plant_protein_natural_choc_-_908g.png?v=1596765459Maxine's New in_stock 69.95 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate https://cdn.shopify.com/s/files/1/0270/2917/6420/products/plantproteinback.png?v=1596765459 32500550238308 4795266596964plantprotein36serves908gvanillabean Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/plant-protein?variant=32500550238308https://cdn.shopify.com/s/files/1/0270/2917/6420/products/plant_protein_natural_creamy_vanilla_-_908g.png?v=1596765459Maxine's New in_stock 69.95 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean https://cdn.shopify.com/s/files/1/0270/2917/6420/products/plantproteinback.png?v=1596765459 32868511973476 4832130760804burnbarsboxof12hazelnutheaven Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868511973476https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-hazelnut-heaven-x12_e76a8eef-cc4c-43f1-bdc4-c14df2d8ddfe.png?v=1600228773Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Hazelnut Heaven 32868512006244 4832130760804burnbarsboxof12coconutdream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512006244https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-coconut-dream-x12_d17fe43a-ea6e-4ded-89a2-0ba6b852fc2f.png?v=1601010899Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Coconut Dream 32868512039012 4832130760804burnbarsboxof12choccaramelcrunch Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512039012https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-carax12_9bb8ac0c-576c-4491-a613-031f97774e97.png?v=1601010895Maxine's New out_of_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Caramel Crunch 32868512071780 4832130760804burnbarsboxof12doublechocfudge Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512071780https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-fudgex12_87e0f55f-30ff-4e1a-aafa-46df652d82db.png?v=1601010895Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Double Choc Fudge 32868512104548 4832130760804burnbarsboxof12cookiescream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512104548https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-cookies-creamx12_746edcd9-0ec1-43f4-b78a-02d9b125918d.png?v=1601010895Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Cookies & Cream 32868512137316 4832130760804burnbarsboxof12chocmocha Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512137316https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-mochax12_206da667-3a77-4c4c-8831-fb0477335ddf.png?v=1601010895Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Mocha 32868512170084 4832130760804burnbarsboxof12chocmintfudge Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512170084https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-mintx12_9fc3548c-e36c-4579-b034-7372975fe605.png?v=1601010895Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Mint Fudge 32868512202852 4832130760804burnbarsboxof12redvelvetcupcake Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512202852https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-red-velvetx12_6ae900fe-59fb-476d-8694-7a3f386fc4a9.png?v=1601010895Maxine's New out_of_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Red Velvet Cupcake 32868512235620 4832130760804burnbarsboxof12whitechocraspberry Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512235620https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-white-choc-raspx12_7e0fd146-c432-40aa-815f-5e743dbd8492.png?v=1601010895Maxine's New out_of_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 White Choc Raspberry 32868512268388 4832130760804burnbarsboxof12mangococonutcream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512268388https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-mango-coconutx12_6eacf38b-5c63-490e-935a-e42e3cb74ab9.png?v=1601010895Maxine's New out_of_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Mango Coconut Cream 32868512301156 4832130760804burnbarsboxof12berrydelight Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512301156https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-berry-delightx12_f483dc10-6e8e-4d5e-92a9-06b04579742c.png?v=1601010895Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Berry Delight 32868512333924 4832130760804burnbarsindividualbarchoccaramelcrunch Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512333924https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-cara_8139803b-b93c-496c-b612-73e7114731be.png?v=1601010899Maxine's New in_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Caramel Crunch 32868512366692 4832130760804burnbarsindividualbardoublechocfudge Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512366692https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-fudge_70260027-2c70-4a82-8f48-162c943fa129.png?v=1601010899Maxine's New in_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Double Choc Fudge 32868512399460 4832130760804burnbarsindividualbarcookiescream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512399460https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-cookies-cream_a28c7fe5-d2b8-43c7-b2ca-16c7baae7a6a.png?v=1601010899Maxine's New in_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Cookies & Cream 32868512432228 4832130760804burnbarsindividualbarchocmocha Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512432228https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-mocha_20cae866-f31c-4ce8-914b-10e65ebd1d2b.png?v=1601010895Maxine's New in_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Mocha 32868512464996 4832130760804burnbarsindividualbarchocmintfudge Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512464996https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-mint_71877341-0510-4e01-9050-3320d9e46062.png?v=1601010895Maxine's New in_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Mint Fudge 32868512497764 4832130760804burnbarsindividualbarredvelvetcupcake Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512497764https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-red-velvet_2476489b-11a9-47f7-b681-eb90e9f9fe70.png?v=1601010895Maxine's New out_of_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Red Velvet Cupcake 32868512530532 4832130760804burnbarsindividualbarwhitechocraspberry Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512530532https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-white-choc-rasp_9da45ee5-9e12-429b-8012-fdeed6c2bf5c.png?v=1601010895Maxine's New out_of_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar White Choc Raspberry 32868512563300 4832130760804burnbarsindividualbarmangococonutcream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512563300https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-mango-coconut_931a4cd7-c5bb-4b7c-8ceb-bf81ae7b4c38.png?v=1601010895Maxine's New out_of_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Mango Coconut Cream 32868512596068 4832130760804burnbarsindividualbarberrydelight Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512596068https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-berry-delight_2faf30ec-b968-4425-9929-632e475738e0.png?v=1601010895Maxine's New in_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Berry Delight 32868512628836 4832130760804burnbarsindividualbarcoconutdream Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512628836https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-coconut-dream_bfeec5dd-2c8c-4b20-b60e-8302451d9640.png?v=1600228773Maxine's New in_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Coconut Dream 32868512661604 4832130760804burnbarsindividualbarhazelnutheaven Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-bars?variant=32868512661604https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-hazelnut-heaven_44229da3-9dd8-40cb-aedf-5db2483c8a4c.png?v=1600228773Maxine's New in_stock 3.95 AUD 2.99 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Hazelnut Heaven 32500532805732 4795267219556burncookiesboxof12chocolate Maxine's BURN Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-cookie?variant=32500532805732https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Burn-Cookie-Double-Chocx12.png?v=1602544875Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Chocolate 32500532838500 4795267219556burncookiesboxof12cookiesncream Maxine's BURN Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-cookie?variant=32500532838500https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Burn-Cookie-cookies_creamx12.png?v=1602544875Maxine's New in_stock 39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Cookies 'N Cream 32500532740196 4795267219556burncookiesindividualcookiechocolate Maxine's BURN Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-cookie?variant=32500532740196https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Burn-Cookie-Double-Choc.png?v=1602544875Maxine's New in_stock 3.95 AUD 2.49 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Chocolate 32500532772964 4795267219556burncookiesindividualcookiecookiesncream Maxine's BURN Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-cookie?variant=32500532772964https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Burn-Cookie-cookies_cream.png?v=1602544875Maxine's New in_stock 3.95 AUD 2.49 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Cookies 'N Cream 32880069279844 4836907876452sipnburn30serves300gfruityfrost Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/sip-n-burn?variant=32880069279844https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Fruity-Frost-1.png?v=1600643544Maxine's New in_stock 49.95 AUD 39.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Fruity Frost https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Fruity-Frost-2.png?v=1600643544https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Fruity-Frost-3.png?v=1600643544https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Going-Grape-2.png?v=1600643545https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Going-Grape-3.png?v=1600643545 32880069312612 4836907876452sipnburn30serves300ggoinggrape Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/sip-n-burn?variant=32880069312612https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Going-Grape-1.png?v=1600643545Maxine's New in_stock 49.95 AUD 39.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Going Grape https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Fruity-Frost-2.png?v=1600643544https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Fruity-Frost-3.png?v=1600643544https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Going-Grape-2.png?v=1600643545https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Sip_N-Burn-Going-Grape-3.png?v=1600643545 32880069345380 4836907909220creaburn30serves300gcolacrush Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/creaburn?variant=32880069345380https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Cola-Crush-1.png?v=1600643496Maxine's New in_stock 49.95 AUD 39.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Cola Crush https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Cola-Crush-2.png?v=1600643496https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Cola-Crush-3.png?v=1600643496https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Grape-Splash-2.png?v=1600643496https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Grape-Splash-3.png?v=1600643496 32880069378148 4836907909220creaburn30serves300ggrapesplash Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/creaburn?variant=32880069378148https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Grape-Splash-1.png?v=1600643496Maxine's New in_stock 49.95 AUD 39.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Grape Splash https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Cola-Crush-2.png?v=1600643496https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Cola-Crush-3.png?v=1600643496https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Grape-Splash-2.png?v=1600643496https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Crea-Burn-Grape-Splash-3.png?v=1600643496 4836907974756 acetyl-l-carnitine-with-matchaMaxine's Acetyl-L Carnitine With Matcha Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/acetyl-l-carnitine-with-matcha https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-alcar_matcha.png?v=1600643362 Maxine's New out_of_stock49.95 AUD 34.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Fat Burners 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4836908007524 cla-conjugated-linoleic-acidMaxine's CLA - Conjugated Linoleic Acid Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/cla-conjugated-linoleic-acid https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-CLA-web.png?v=1600643455 Maxine's New in_stock39.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Fat Burners 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4836907941988 burn-capsMaxine's Burn Caps Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/burn-caps https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn_caps_sample.png?v=1600643427 Maxine's New in_stock59.95 AUD 49.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Fat Burners 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 32943463465060 4820381007972beginnerburnpackchocfudgebrowniechocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463465060https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse 32943463596132 4820381007972beginnerburnpackchocfudgebrownievanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463596132https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream 32943463727204 4820381007972beginnerburnpackvanillaicecreamchocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463727204https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse 32943463858276 4820381007972beginnerburnpackvanillaicecreamvanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463858276https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream 32943463989348 4820381007972beginnerburnpackchocolatehoneycombchocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463989348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse 32943464120420 4820381007972beginnerburnpackchocolatehoneycombvanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464120420https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream 32943464251492 4820381007972beginnerburnpacksaltedcaramelchocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464251492https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse 32943464382564 4820381007972beginnerburnpacksaltedcaramelvanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464382564https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream 32943464513636 4820381007972beginnerburnpackberrycheesecakechocolatemousse Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464513636https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse 32943464644708 4820381007972beginnerburnpackberrycheesecakevanilladream Maxine's Beginner Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464644708https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Beginner.png?v=1597809139Maxine's New in_stock 70.75 AUD 59.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream 32943516123236 4820382285924intermediateburnpackchocfudgebrowniechocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516123236https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Fruity Frost 32943516156004 4820382285924intermediateburnpackchocfudgebrowniechocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516156004https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Going Grape 32943516188772 4820382285924intermediateburnpackchocfudgebrownievanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516188772https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Fruity Frost 32943516221540 4820382285924intermediateburnpackchocfudgebrownievanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516221540https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Going Grape 32943516254308 4820382285924intermediateburnpackvanillaicecreamchocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516254308https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Fruity Frost 32943516287076 4820382285924intermediateburnpackvanillaicecreamchocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516287076https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Going Grape 32943516319844 4820382285924intermediateburnpackvanillaicecreamvanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516319844https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Fruity Frost 32943516352612 4820382285924intermediateburnpackvanillaicecreamvanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516352612https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Going Grape 32943516385380 4820382285924intermediateburnpackchocolatehoneycombchocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516385380https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse Fruity Frost 32943516418148 4820382285924intermediateburnpackchocolatehoneycombchocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516418148https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse Going Grape 32943516450916 4820382285924intermediateburnpackchocolatehoneycombvanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516450916https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream Fruity Frost 32943516483684 4820382285924intermediateburnpackchocolatehoneycombvanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516483684https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream Going Grape 32943516516452 4820382285924intermediateburnpacksaltedcaramelchocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516516452https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse Fruity Frost 32943516549220 4820382285924intermediateburnpacksaltedcaramelchocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516549220https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse Going Grape 32943516581988 4820382285924intermediateburnpacksaltedcaramelvanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516581988https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream Fruity Frost 32943516614756 4820382285924intermediateburnpacksaltedcaramelvanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516614756https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream Going Grape 32943516647524 4820382285924intermediateburnpackberrycheesecakechocolatemoussefruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516647524https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse Fruity Frost 32943516680292 4820382285924intermediateburnpackberrycheesecakechocolatemoussegoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516680292https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse Going Grape 32943516713060 4820382285924intermediateburnpackberrycheesecakevanilladreamfruityfrost Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516713060https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream Fruity Frost 32943516745828 4820382285924intermediateburnpackberrycheesecakevanilladreamgoinggrape Maxine's Intermediate Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516745828https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 186.80 AUD 159.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream Going Grape 32943555477604 4820382351460advancedburnpackchocfudgebrowniechocolatemoussefruityfrost Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555477604https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Advanced.png?v=1597809793Maxine's New in_stock 289.95 AUD 245.00 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Fruity Frost 32943555510372 4820382351460advancedburnpackchocfudgebrowniechocolatemoussegoinggrape Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555510372https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Advanced.png?v=1597809793Maxine's New in_stock 289.95 AUD 245.00 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Going Grape 32943555543140 4820382351460advancedburnpackchocfudgebrownievanilladreamfruityfrost Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555543140https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Advanced.png?v=1597809793Maxine's New in_stock 289.95 AUD 245.00 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Fruity Frost 32943555575908 4820382351460advancedburnpackchocfudgebrownievanilladreamgoinggrape Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555575908https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Advanced.png?v=1597809793Maxine's New in_stock 289.95 AUD 245.00 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Going Grape 32943555608676 4820382351460advancedburnpackvanillaicecreamchocolatemoussefruityfrost Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555608676https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Advanced.png?v=1597809793Maxine's New in_stock 289.95 AUD 245.00 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Fruity Frost 32943555641444 4820382351460advancedburnpackvanillaicecreamchocolatemoussegoinggrape Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555641444https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Advanced.png?v=1597809793Maxine's New in_stock 289.95 AUD 245.00 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Going Grape 32943555674212 4820382351460advancedburnpackvanillaicecreamvanilladreamfruityfrost Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555674212https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Advanced.png?v=1597809793Maxine's New out_of_stock 289.95 AUD 245.00 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Fruity Frost 32943555706980 4820382351460advancedburnpackvanillaicecreamvanilladreamgoinggrape Maxine's Advanced Burn Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555706980https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Advanced.png?v=1597809793Maxine's New in_stock 289.95 AUD 245.00 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Going Grape 32606896750692 4823374692452veganstarterpack36serves908gnaturalchocolate36serves908gnaturalchocola Maxine's Vegan Starter Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/vegan-protein-pack?variant=32606896750692https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-vegan-pack-beginner.png?v=1598587852Maxine's New out_of_stock 129.95 AUD 119.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) - Natural Chocolate 36 Serves (908g) - Natural Chocolate Acetyl L Carnitine Capsules 32606896783460 4823374692452veganstarterpack36serves908gnaturalchocolate36serves908gvanillabeanace Maxine's Vegan Starter Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/vegan-protein-pack?variant=32606896783460https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-vegan-pack-beginner.png?v=1598587852Maxine's New out_of_stock 129.95 AUD 119.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) - Natural Chocolate 36 Serves (908g) - Vanilla Bean Acetyl L Carnitine Capsules 32606896816228 4823374692452veganstarterpack36serves908gvanillabean36serves908gnaturalchocolateace Maxine's Vegan Starter Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/vegan-protein-pack?variant=32606896816228https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-vegan-pack-beginner.png?v=1598587852Maxine's New out_of_stock 129.95 AUD 119.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) - Vanilla Bean 36 Serves (908g) - Natural Chocolate Acetyl L Carnitine Capsules 32606896848996 4823374692452veganstarterpack36serves908gvanillabean36serves908gvanillabeanacetyllc Maxine's Vegan Starter Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/vegan-protein-pack?variant=32606896848996https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-vegan-pack-beginner.png?v=1598587852Maxine's New out_of_stock 129.95 AUD 119.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) - Vanilla Bean 36 Serves (908g) - Vanilla Bean Acetyl L Carnitine Capsules 32880586948708 4836964237412advancedveganpack36serves908gnaturalchocolate36serves908gnaturalchocol Maxine's Advanced Vegan Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/advanced-vegan-pack?variant=32880586948708https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-vegan-pack-Advanced.png?v=1600661400Maxine's New out_of_stock 249.95 AUD 199.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) Natural Chocolate 36 Serves (908g) Natural Chocolate 32880586981476 4836964237412advancedveganpack36serves908gnaturalchocolate36serves908gvanillabean Maxine's Advanced Vegan Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/advanced-vegan-pack?variant=32880586981476https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-vegan-pack-Advanced.png?v=1600661400Maxine's New out_of_stock 249.95 AUD 199.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) Natural Chocolate 36 Serves (908g) Vanilla Bean 32880587014244 4836964237412advancedveganpack36serves908gvanillabean36serves908gnaturalchocolate Maxine's Advanced Vegan Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/advanced-vegan-pack?variant=32880587014244https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-vegan-pack-Advanced.png?v=1600661400Maxine's New out_of_stock 249.95 AUD 199.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) Vanilla Bean 36 Serves (908g) Natural Chocolate 32880587047012 4836964237412advancedveganpack36serves908gvanillabean36serves908gvanillabean Maxine's Advanced Vegan Pack Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/advanced-vegan-pack?variant=32880587047012https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-vegan-pack-Advanced.png?v=1600661400Maxine's New out_of_stock 249.95 AUD 199.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) Vanilla Bean 36 Serves (908g) Vanilla Bean 32880246030436 4836918886500twinpackburnprotein20serves500gchocfudgebrowniechocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246030436https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Choc Fudge Brownie 32880246063204 4836918886500twinpackburnprotein20serves500gchocfudgebrownieberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246063204https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Berry Cheesecake 32880246095972 4836918886500twinpackburnprotein20serves500gchocfudgebrownievanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246095972https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Vanilla Ice Cream 32880246128740 4836918886500twinpackburnprotein20serves500gchocfudgebrowniechochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246128740https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Choc Honeycomb 32880246161508 4836918886500twinpackburnprotein20serves500gchocfudgebrowniesaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246161508https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Salted Caramel 32880246194276 4836918886500twinpackburnprotein20serves500gberrycheesecakechocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246194276https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Choc Fudge Brownie 32880246227044 4836918886500twinpackburnprotein20serves500gberrycheesecakeberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246227044https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Berry Cheesecake 32880246259812 4836918886500twinpackburnprotein20serves500gberrycheesecakevanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246259812https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Vanilla Ice Cream 32880246292580 4836918886500twinpackburnprotein20serves500gberrycheesecakechochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246292580https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Choc Honeycomb 32880246325348 4836918886500twinpackburnprotein20serves500gberrycheesecakesaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246325348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Salted Caramel 32880246358116 4836918886500twinpackburnprotein20serves500gvanillaicecreamchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246358116https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Choc Fudge Brownie 32880246390884 4836918886500twinpackburnprotein20serves500gvanillaicecreamberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246390884https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Berry Cheesecake 32880246423652 4836918886500twinpackburnprotein20serves500gvanillaicecreamvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246423652https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Vanilla Ice Cream 32880246456420 4836918886500twinpackburnprotein20serves500gvanillaicecreamchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246456420https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Choc Honeycomb 32880246489188 4836918886500twinpackburnprotein20serves500gvanillaicecreamsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246489188https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Salted Caramel 32880246521956 4836918886500twinpackburnprotein20serves500gchochoneycombchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246521956https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Choc Fudge Brownie 32880246554724 4836918886500twinpackburnprotein20serves500gchochoneycombberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246554724https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Berry Cheesecake 32880246587492 4836918886500twinpackburnprotein20serves500gchochoneycombvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246587492https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Vanilla Ice Cream 32880246620260 4836918886500twinpackburnprotein20serves500gchochoneycombchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246620260https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Choc Honeycomb 32880246653028 4836918886500twinpackburnprotein20serves500gchochoneycombsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246653028https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Salted Caramel 32880246685796 4836918886500twinpackburnprotein20serves500gsaltedcaramelchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246685796https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Choc Fudge Brownie 32880246718564 4836918886500twinpackburnprotein20serves500gsaltedcaramelberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246718564https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Berry Cheesecake 32880246751332 4836918886500twinpackburnprotein20serves500gsaltedcaramelvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246751332https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Vanilla Ice Cream 32880246784100 4836918886500twinpackburnprotein20serves500gsaltedcaramelchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246784100https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Choc Honeycomb 32880246816868 4836918886500twinpackburnprotein20serves500gsaltedcaramelsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246816868https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 69.90 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Salted Caramel 32880246849636 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniechocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246849636https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Choc Fudge Brownie 32880246882404 4836918886500twinpackburnprotein50serves125kgchocfudgebrownieberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246882404https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Berry Cheesecake 32880246915172 4836918886500twinpackburnprotein50serves125kgchocfudgebrownievanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246915172https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Vanilla Ice Cream 32880246947940 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniechochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246947940https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Choc Honeycomb 32880246980708 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniesaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246980708https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Salted Caramel 32880247013476 4836918886500twinpackburnprotein50serves125kgberrycheesecakechocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247013476https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Choc Fudge Brownie 32880247046244 4836918886500twinpackburnprotein50serves125kgberrycheesecakeberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247046244https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Berry Cheesecake 32880247079012 4836918886500twinpackburnprotein50serves125kgberrycheesecakevanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247079012https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Vanilla Ice Cream 32880247111780 4836918886500twinpackburnprotein50serves125kgberrycheesecakechochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247111780https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Choc Honeycomb 32880247144548 4836918886500twinpackburnprotein50serves125kgberrycheesecakesaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247144548https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Salted Caramel 32880247177316 4836918886500twinpackburnprotein50serves125kgvanillaicecreamchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247177316https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Choc Fudge Brownie 32880247210084 4836918886500twinpackburnprotein50serves125kgvanillaicecreamberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247210084https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Berry Cheesecake 32880247242852 4836918886500twinpackburnprotein50serves125kgvanillaicecreamvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247242852https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Vanilla Ice Cream 32880247275620 4836918886500twinpackburnprotein50serves125kgvanillaicecreamchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247275620https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Choc Honeycomb 32880247308388 4836918886500twinpackburnprotein50serves125kgvanillaicecreamsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247308388https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Salted Caramel 32880247341156 4836918886500twinpackburnprotein50serves125kgchochoneycombchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247341156https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Choc Fudge Brownie 32880247373924 4836918886500twinpackburnprotein50serves125kgchochoneycombberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247373924https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Berry Cheesecake 32880247406692 4836918886500twinpackburnprotein50serves125kgchochoneycombvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247406692https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Vanilla Ice Cream 32880247439460 4836918886500twinpackburnprotein50serves125kgchochoneycombchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247439460https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Choc Honeycomb 32880247472228 4836918886500twinpackburnprotein50serves125kgchochoneycombsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247472228https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Salted Caramel 32880247504996 4836918886500twinpackburnprotein50serves125kgsaltedcaramelchocfudgebrownie Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247504996https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Choc Fudge Brownie 32880247537764 4836918886500twinpackburnprotein50serves125kgsaltedcaramelberrycheesecake Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247537764https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Berry Cheesecake 32880247570532 4836918886500twinpackburnprotein50serves125kgsaltedcaramelvanillaicecream Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247570532https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Vanilla Ice Cream 32880247603300 4836918886500twinpackburnprotein50serves125kgsaltedcaramelchochoneycomb Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247603300https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Choc Honeycomb 32880247636068 4836918886500twinpackburnprotein50serves125kgsaltedcaramelsaltedcaramel Twin Pack: Maxine's Burn Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247636068https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Salted Caramel 32880256090212 4836918460516twinpacknightprotein20serves500gchocolatemoussechocolatemousse Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256090212https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 79.95 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse Chocolate Mousse 32880256122980 4836918460516twinpacknightprotein20serves500gchocolatemoussevanilladream Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256122980https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 79.95 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse Vanilla Dream 32880256155748 4836918460516twinpacknightprotein20serves500gvanilladreamchocolatemousse Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256155748https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 79.95 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream Chocolate Mousse 32880256188516 4836918460516twinpacknightprotein20serves500gvanilladreamvanilladream Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256188516https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 79.95 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream Vanilla Dream 32880256221284 4836918460516twinpacknightprotein40serves1kgchocolatemoussechocolatemousse Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256221284https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 119.95 AUD 89.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse Chocolate Mousse 32880256254052 4836918460516twinpacknightprotein40serves1kgchocolatemoussevanilladream Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256254052https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 119.95 AUD 89.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse Vanilla Dream 32880256286820 4836918460516twinpacknightprotein40serves1kgvanilladreamchocolatemousse Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256286820https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 119.95 AUD 89.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream Chocolate Mousse 32880256319588 4836918460516twinpacknightprotein40serves1kgvanilladreamvanilladream Twin Pack: Maxine's Night Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256319588https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 119.95 AUD 89.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream Vanilla Dream 32880265527396 4836919640164twinpackplantprotein16serves400gnaturalchocolatenaturalchocolate Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265527396https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New in_stock 79.95 AUD 62.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate Natural Chocolate 32880265560164 4836919640164twinpackplantprotein16serves400gnaturalchocolatevanillabean Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265560164https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 79.95 AUD 62.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate Vanilla Bean 32880265592932 4836919640164twinpackplantprotein16serves400gvanillabeannaturalchocolate Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265592932https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 79.95 AUD 62.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean Natural Chocolate 32880265625700 4836919640164twinpackplantprotein16serves400gvanillabeanvanillabean Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265625700https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 79.95 AUD 62.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean Vanilla Bean 32880265658468 4836919640164twinpackplantprotein36serves908gnaturalchocolatenaturalchocolate Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265658468https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate Natural Chocolate 32880265691236 4836919640164twinpackplantprotein36serves908gnaturalchocolatevanillabean Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265691236https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate Vanilla Bean 32880265724004 4836919640164twinpackplantprotein36serves908gvanillabeannaturalchocolate Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265724004https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean Natural Chocolate 32880265756772 4836919640164twinpackplantprotein36serves908gvanillabeanvanillabean Twin Pack: Maxine's Plant Protein Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265756772https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New in_stock 139.95 AUD 107.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean Vanilla Bean 4836920557668 twin-pack-burn-barsTwin Pack: Maxine's Burn Bars Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-burn-bars https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bar-twin-pack.png?v=1600659471 Maxine's New in_stock7.95 AUD 5.29 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Hazelnut Heaven 4836920590436 twin-pack-burn-cookiesTwin Pack: Maxine's Burn Cookies Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-burn-cookies https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-cookie-twin-pack.png?v=1600659463 Maxine's New in_stock7.95 AUD 5.29 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate 32880269688932 4836919902308twinpacksipnburnfruityfrostfruityfrost Twin Pack: Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-sip-n-burn?variant=32880269688932https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-sip-n-burn-twin-pack.png?v=1600659451Maxine's New in_stock 99.95 AUD 71.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Fruity Frost Fruity Frost 32880269721700 4836919902308twinpacksipnburnfruityfrostgoinggrape Twin Pack: Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-sip-n-burn?variant=32880269721700https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-sip-n-burn-twin-pack.png?v=1600659451Maxine's New in_stock 99.95 AUD 71.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Fruity Frost Going Grape 32880269754468 4836919902308twinpacksipnburngoinggrapefruityfrost Twin Pack: Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-sip-n-burn?variant=32880269754468https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-sip-n-burn-twin-pack.png?v=1600659451Maxine's New in_stock 99.95 AUD 71.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Going Grape Fruity Frost 32880269787236 4836919902308twinpacksipnburngoinggrapegoinggrape Twin Pack: Maxine's Sip N' Burn Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-sip-n-burn?variant=32880269787236https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-sip-n-burn-twin-pack.png?v=1600659451Maxine's New in_stock 99.95 AUD 71.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Going Grape Going Grape 32880274374756 4836920328292twinpackcreaburncolacrushcolacrush Twin Pack: Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-creaburn?variant=32880274374756https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-creaburn-twin-pack.png?v=1600659457Maxine's New in_stock 99.95 AUD 71.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cola Crush Cola Crush 32880274407524 4836920328292twinpackcreaburncolacrushgrapesplash Twin Pack: Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-creaburn?variant=32880274407524https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-creaburn-twin-pack.png?v=1600659457Maxine's New in_stock 99.95 AUD 71.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cola Crush Grape Splash 32880274440292 4836920328292twinpackcreaburngrapesplashcolacrush Twin Pack: Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-creaburn?variant=32880274440292https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-creaburn-twin-pack.png?v=1600659457Maxine's New in_stock 99.95 AUD 71.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Grape Splash Cola Crush 32880274473060 4836920328292twinpackcreaburngrapesplashgrapesplash Twin Pack: Maxine's Crea BURN Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-creaburn?variant=32880274473060https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-creaburn-twin-pack.png?v=1600659457Maxine's New in_stock 99.95 AUD 71.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Grape Splash Grape Splash 4836920361060 twin-pack-acetyl-l-carnitine-capsulesTwin Pack: Maxine's Acetyl-L Carnitine Capsules Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-acetyl-l-carnitine-with-matcha https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-alcar-twin-pack.png?v=1600659474 Maxine's New out_of_stock79.90 AUD 62.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4836920754276 twin-pack-cla-capsulesTwin Pack: Maxine's CLA Capsules Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-cla-capsules https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-cla-twin-pack.png?v=1600659456 Maxine's New in_stock79.95 AUD 53.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4836920655972 twin-pack-burn-capsTwin Pack: Maxine's Burn Caps Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/twin-pack-burn-caps https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-caps-twin-pack.png?v=1600659466 Maxine's New in_stock119.90 AUD 89.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4816552198244 maxines-premium-shakerMaxine's Premium Shaker Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-premium-shaker https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines_shaker.png?v=1596765488 Maxine's New in_stock19.95 AUD 14.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4816000516196 pink-training-singletMaxine's Pink Training Singlet Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/pink-training-singlet https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-i-can-racerback-pink.png?v=1596765569 Maxine's New in_stock34.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayXS 4816552132708 black-training-singletMaxine's Black Training Singlet Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/black-training-singlet https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-women-who-lift-racerback-black.png?v=1596765565 Maxine's New in_stock34.95 AUD 29.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayXS 4816552362084 maxines-training-t-shirtMaxine's Training T-Shirt Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/maxines-training-t-shirt https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines.top.png?v=1596765574 Maxine's New in_stock29.95 AUD 12.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay6 32583911604324 4795267285092tmctotalmealcookieindividualcookiechocmint Maxine's TMC Total Meal Cookie Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/tmc-total-meal-cookie?variant=32583911604324https://cdn.shopify.com/s/files/1/0270/2917/6420/products/BURN-TMC-Choc-Mint-Delight.png?v=1596765166Maxine's New out_of_stock 3.99 AUD 3.49 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Choc Mint 32583911637092 4795267285092tmctotalmealcookieindividualcookiedoublechocolate Maxine's TMC Total Meal Cookie Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/tmc-total-meal-cookie?variant=32583911637092https://cdn.shopify.com/s/files/1/0270/2917/6420/products/BURN-TMC-Choc-Double-Chocolate.png?v=1596765166Maxine's New out_of_stock 3.99 AUD 3.49 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Double Chocolate 32583911669860 4795267285092tmctotalmealcookieindividualcookiechocraspberryorangetwist Maxine's TMC Total Meal Cookie Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/tmc-total-meal-cookie?variant=32583911669860https://cdn.shopify.com/s/files/1/0270/2917/6420/products/BURN-TMC-Choc-Raspberry-Orange-Twist.png?v=1596765180Maxine's New out_of_stock 3.99 AUD 3.49 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Choc Raspberry Orange Twist 32583911702628 4795267285092tmctotalmealcookieboxof12chocmint Maxine's TMC Total Meal Cookie Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/tmc-total-meal-cookie?variant=32583911702628https://cdn.shopify.com/s/files/1/0270/2917/6420/products/BURN-TMC-Choc-Mint-Delight-Box.png?v=1596765199Maxine's New out_of_stock 49.95 AUD 39.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Mint 32583911735396 4795267285092tmctotalmealcookieboxof12doublechocolate Maxine's TMC Total Meal Cookie Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/tmc-total-meal-cookie?variant=32583911735396https://cdn.shopify.com/s/files/1/0270/2917/6420/products/BURN-TMC-Double-Chocolate-Box.png?v=1596765210Maxine's New out_of_stock 49.95 AUD 39.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Double Chocolate 32583911768164 4795267285092tmctotalmealcookieboxof12chocraspberryorangetwist Maxine's TMC Total Meal Cookie Shop Online at Maxine's Australia™ - Premium Proteins and Supplements. Order today for a discounted price and guaranteed fast shipping! https://maxinesburn.com/products/tmc-total-meal-cookie?variant=32583911768164https://cdn.shopify.com/s/files/1/0270/2917/6420/products/BURN-TMC-Choc-Raspberry-Orange-Twist-Box.png?v=1596765227Maxine's New out_of_stock 49.95 AUD 39.95 AUD 2020-10-27T15:30:47+1100/2020-11-26T15:30:47+1100 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Raspberry Orange Twist