Maxine's Burn https://maxinesburn.com Maxine’s is Australian Made & Australian Owned Quality Supplements. Protein, Bars, Fat Burning, Weight Loss. Browse the Selection Today. 39409904648292 4795266400356burn20serves500gcookiescream Maxine's BURN - 20 Serves (500g) - Cookies & Cream Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=39409904648292https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Burn-Cookies-_-Cream-500g-new.png?v=1630977454Maxine's New in_stock 51.55 AUD 42.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Cookies & Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 39409904975972 4795266400356burn20serves500gicedmochaccino Maxine's BURN - 20 Serves (500g) - Iced Mochaccino Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=39409904975972https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Burn-Iced-Mocha-new.png?v=1630977428Maxine's New in_stock 51.55 AUD 42.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Iced Mochaccino https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489388132 4795266400356burn20serves500gchocfudgebrownie Maxine's BURN - 20 Serves (500g) - Choc Fudge Brownie Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489388132https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Choc-Fudge-Brownie.png?v=1596764560Maxine's New in_stock 51.55 AUD 42.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489453668 4795266400356burn20serves500gvanillaicecream Maxine's BURN - 20 Serves (500g) - Vanilla Ice Cream Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489453668https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Vanilla-Ice-Cream.png?v=1596764560Maxine's New in_stock 51.55 AUD 42.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489486436 4795266400356burn20serves500gchochoneycomb Maxine's BURN - 20 Serves (500g) - Choc Honeycomb Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489486436https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Choc-Honeycomb.png?v=1596764560Maxine's New in_stock 51.55 AUD 42.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489519204 4795266400356burn20serves500gsaltedcaramel Maxine's BURN - 20 Serves (500g) - Salted Caramel Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489519204https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Salted-Caramel_602a3844-06da-4fc4-843f-cd1823e195cb.png?v=1596764560Maxine's New in_stock 51.55 AUD 42.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489420900 4795266400356burn20serves500gberrycheesecake Maxine's BURN - 20 Serves (500g) - Berry Cheesecake Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489420900https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-Berry-Cheesecake.png?v=1596764560Maxine's New in_stock 51.55 AUD 42.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 39409905139812 4795266400356burn50serves125kgcookiescream Maxine's BURN - 50 Serves (1.25kg) - Cookies & Cream Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=39409905139812https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Burn-Cookies-_-Cream-new.png?v=1630977587Maxine's New in_stock 101.95 AUD 84.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Cookies & Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 39409904812132 4795266400356burn50serves125kgicedmochaccino Maxine's BURN - 50 Serves (1.25kg) - Iced Mochaccino Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=39409904812132https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Burn-Iced-Mocha-500g-new.png?v=1630977414Maxine's New in_stock 101.95 AUD 84.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Iced Mochaccino https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489551972 4795266400356burn50serves125kgchocfudgebrownie Maxine's BURN - 50 Serves (1.25kg) - Choc Fudge Brownie Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489551972https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Choc-Fudge-Brownie.png?v=1596764560Maxine's New in_stock 101.95 AUD 84.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489617508 4795266400356burn50serves125kgvanillaicecream Maxine's BURN - 50 Serves (1.25kg) - Vanilla Ice Cream Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489617508https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Vanilla-Ice-Cream.png?v=1596764560Maxine's New in_stock 101.95 AUD 84.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489650276 4795266400356burn50serves125kgchochoneycomb Maxine's BURN - 50 Serves (1.25kg) - Choc Honeycomb Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489650276https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Chocolate-Honeycomb.png?v=1596764560Maxine's New in_stock 101.95 AUD 84.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489683044 4795266400356burn50serves125kgsaltedcaramel Maxine's BURN - 50 Serves (1.25kg) - Salted Caramel Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489683044https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Salted-Caramel.png?v=1596764560Maxine's New in_stock 101.95 AUD 84.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500489584740 4795266400356burn50serves125kgberrycheesecake Maxine's BURN - 50 Serves (1.25kg) - Berry Cheesecake Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32500489584740https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Berry-Cheesecake.png?v=1596764560Maxine's New in_stock 101.95 AUD 84.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32605988225124 4795266400356burn90serves22kgchocfudgebrownie Maxine's BURN - 90 Serves (2.2kg) - Choc Fudge Brownie Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32605988225124https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Fudge-Brownie.png?v=1631502112Maxine's New in_stock 161.95 AUD 134.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Choc Fudge Brownie https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32605988388964 4795266400356burn90serves22kgvanillaicecream Maxine's BURN - 90 Serves (2.2kg) - Vanilla Ice Cream Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=32605988388964https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Vanilla-Ice-Cream.png?v=1631502088Maxine's New in_stock 161.95 AUD 134.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Vanilla Ice Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 33061980831844 4795266400356burn90serves22kgchochoneycomb Maxine's BURN - 90 Serves (2.2kg) - Choc Honeycomb Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=33061980831844https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-1.25kg-Chocolate-Honeycomb.png?v=1596764560Maxine's New in_stock 161.95 AUD 134.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Choc Honeycomb https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 33061980864612 4795266400356burn90serves22kgsaltedcaramel Maxine's BURN - 90 Serves (2.2kg) - Salted Caramel Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=33061980864612https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Salted-Caramel.png?v=1631502011Maxine's New in_stock 161.95 AUD 134.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Salted Caramel https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 33061980569700 4795266400356burn90serves22kgcookiescream Maxine's BURN - 90 Serves (2.2kg) - Cookies & Cream Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=33061980569700https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Burn-Cookies-_-Cream-new.png?v=1630977587Maxine's New out_of_stock 161.95 AUD 134.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Cookies & Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 39409918443620 4795266400356burn90serves22kgicedmochaccino Maxine's BURN - 90 Serves (2.2kg) - Iced Mochaccino Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=39409918443620https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Burn-Iced-Mocha-new.png?v=1630977428Maxine's New out_of_stock 161.95 AUD 134.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Iced Mochaccino https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 39413716222052 4795266400356burn90serves22kgberrycheesecake Maxine's BURN - 90 Serves (2.2kg) - Berry Cheesecake Maxine’s BURN is the ideal addition to your busy lifestyle. This high protein formula is designed to help you feel strong and vital - and look great! Maxine’s BURN is low in carbs, fats and sugar, and contains natural fat metabolising nutrients to help shift stubborn fat stores and and support a lean strong body. If you do regular weight training or cardio, want to strip body fat, or you simply live an active and busy lifestyle, Maxine’s BURN will enhance your nutrition and help you get strong, feel great, look amazing, and get the very best from your body.https://maxinesburn.com/products/burn?variant=39413716222052https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Berry-Cheesecake.png?v=1631501863Maxine's New in_stock 161.95 AUD 134.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Berry Cheesecake https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-RHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-500g-LHS.png?v=1596764560https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-2.25kg-Choc-Honeycomb.png?v=1631502050 32500491190372 4795266531428night20serves500gchocolatemousse Maxine's NIGHT - 20 Serves (500g) - Chocolate Mousse All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle, https://maxinesburn.com/products/night?variant=32500491190372https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night_Choc_500g.png?v=1668060106Maxine's New in_stock 47.95 AUD 39.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse 32500491223140 4795266531428night20serves500gvanilladream Maxine's NIGHT - 20 Serves (500g) - Vanilla Dream All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle, https://maxinesburn.com/products/night?variant=32500491223140https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night_Vanilla_500g.png?v=1668060106Maxine's New in_stock 47.95 AUD 39.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream 32500491255908 4795266531428night40serves1kgchocolatemousse Maxine's NIGHT - 40 Serves (1kg) - Chocolate Mousse All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle, https://maxinesburn.com/products/night?variant=32500491255908https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night_Choc_1kg.png?v=1668060106Maxine's New in_stock 89.95 AUD 74.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse 32500491288676 4795266531428night40serves1kgvanilladream Maxine's NIGHT - 40 Serves (1kg) - Vanilla Dream All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle, https://maxinesburn.com/products/night?variant=32500491288676https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night_Vanilla_1kg.png?v=1668060106Maxine's New in_stock 89.95 AUD 74.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream 39323044610148 4795266531428night20serves500gsaltedcaramel Maxine's NIGHT - 20 Serves (500g) - Salted Caramel All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle, https://maxinesburn.com/products/night?variant=39323044610148https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night-Salted-Caramel-500g.png?v=1668060106Maxine's New in_stock 47.95 AUD 39.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel 39323044642916 4795266531428night40serves1kgsaltedcaramel Maxine's NIGHT - 40 Serves (1kg) - Salted Caramel All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle, https://maxinesburn.com/products/night?variant=39323044642916https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Night-Salted-Caramel-1kg.png?v=1668060106Maxine's New in_stock 89.95 AUD 74.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Salted Caramel 32868512039012 4832130760804burnbarsboxof12choccaramelcrunch Maxine's Burn Bars - Box of 12 - Choc Caramel Crunch Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512039012https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-choc-caramel-crunch.png?v=1618376763Maxine's New out_of_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Caramel Crunch https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512137316 4832130760804burnbarsboxof12chocmocha Maxine's Burn Bars - Box of 12 - Choc Mocha Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512137316https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-choc-mocha.png?v=1618376763Maxine's New in_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Mocha https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512071780 4832130760804burnbarsboxof12doublechocfudge Maxine's Burn Bars - Box of 12 - Double Choc Fudge Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512071780https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-double-choc-fudge.png?v=1618376763Maxine's New in_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Double Choc Fudge https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512104548 4832130760804burnbarsboxof12cookiescream Maxine's Burn Bars - Box of 12 - Cookies & Cream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512104548https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coockies-and-cream.png?v=1618376763Maxine's New in_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Cookies & Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512170084 4832130760804burnbarsboxof12chocmintfudge Maxine's Burn Bars - Box of 12 - Choc Mint Fudge Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512170084https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-choc-mint-fudge.png?v=1618376763Maxine's New out_of_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Mint Fudge https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868511973476 4832130760804burnbarsboxof12hazelnutheaven Maxine's Burn Bars - Box of 12 - Hazelnut Heaven Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868511973476https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-hazlenut-heaven.png?v=1618376763Maxine's New in_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Hazelnut Heaven https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512202852 4832130760804burnbarsboxof12redvelvetcupcake Maxine's Burn Bars - Box of 12 - Red Velvet Cupcake Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512202852https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-red-velvet-cupcake.png?v=1618376763Maxine's New in_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Red Velvet Cupcake https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512235620 4832130760804burnbarsboxof12whitechocraspberry Maxine's Burn Bars - Box of 12 - White Choc Raspberry Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512235620https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-white-choc-raspberry.png?v=1618376763Maxine's New in_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 White Choc Raspberry https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512268388 4832130760804burnbarsboxof12mangococonutcream Maxine's Burn Bars - Box of 12 - Mango Coconut Cream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512268388https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-mango-coconut-cream.png?v=1618376763Maxine's New in_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Mango Coconut Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512301156 4832130760804burnbarsboxof12berrydelight Maxine's Burn Bars - Box of 12 - Berry Delight Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512301156https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-berry-delight.png?v=1618376763Maxine's New in_stock 41.95 AUD 35.99 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Berry Delight https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512333924 4832130760804burnbarsindividualbarchoccaramelcrunch Maxine's Burn Bars - Individual Bar - Choc Caramel Crunch Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512333924https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-cara_8139803b-b93c-496c-b612-73e7114731be.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Caramel Crunch https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512432228 4832130760804burnbarsindividualbarchocmocha Maxine's Burn Bars - Individual Bar - Choc Mocha Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512432228https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-mocha_20cae866-f31c-4ce8-914b-10e65ebd1d2b.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Mocha https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512366692 4832130760804burnbarsindividualbardoublechocfudge Maxine's Burn Bars - Individual Bar - Double Choc Fudge Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512366692https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-fudge_70260027-2c70-4a82-8f48-162c943fa129.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Double Choc Fudge https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512399460 4832130760804burnbarsindividualbarcookiescream Maxine's Burn Bars - Individual Bar - Cookies & Cream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512399460https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-cookies-cream_a28c7fe5-d2b8-43c7-b2ca-16c7baae7a6a.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Cookies & Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512464996 4832130760804burnbarsindividualbarchocmintfudge Maxine's Burn Bars - Individual Bar - Choc Mint Fudge Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512464996https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-choc-mint_71877341-0510-4e01-9050-3320d9e46062.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Mint Fudge https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512628836 4832130760804burnbarsindividualbarcoconutdream Maxine's Burn Bars - Individual Bar - Coconut Dream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512628836https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-coconut-dream_bfeec5dd-2c8c-4b20-b60e-8302451d9640.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Coconut Dream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512661604 4832130760804burnbarsindividualbarhazelnutheaven Maxine's Burn Bars - Individual Bar - Hazelnut Heaven Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512661604https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-hazelnut-heaven_44229da3-9dd8-40cb-aedf-5db2483c8a4c.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Hazelnut Heaven https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512497764 4832130760804burnbarsindividualbarredvelvetcupcake Maxine's Burn Bars - Individual Bar - Red Velvet Cupcake Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512497764https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-red-velvet_2476489b-11a9-47f7-b681-eb90e9f9fe70.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Red Velvet Cupcake https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512530532 4832130760804burnbarsindividualbarwhitechocraspberry Maxine's Burn Bars - Individual Bar - White Choc Raspberry Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512530532https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-white-choc-rasp_9da45ee5-9e12-429b-8012-fdeed6c2bf5c.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar White Choc Raspberry https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512563300 4832130760804burnbarsindividualbarmangococonutcream Maxine's Burn Bars - Individual Bar - Mango Coconut Cream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512563300https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-mango-coconut_931a4cd7-c5bb-4b7c-8ceb-bf81ae7b4c38.png?v=1618376763Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Mango Coconut Cream https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32868512596068 4832130760804burnbarsindividualbarberrydelight Maxine's Burn Bars - Individual Bar - Berry Delight Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.https://maxinesburn.com/products/burn-bars?variant=32868512596068https://cdn.shopify.com/s/files/1/0270/2917/6420/products/burn-bar-berry-delight_2faf30ec-b968-4425-9929-632e475738e0.png?v=1618376753Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Berry Delight https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bars-box-of-12-coconut-dream.png?v=1618376763 32500532805732 4795267219556burncookiesboxof12chocolate Maxine's BURN Cookies - Box of 12 - Chocolate Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you get lean and strong. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients, They are the ideal fat stripping snack. https://maxinesburn.com/products/burn-cookie?variant=32500532805732https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-cookies-box-of-12-double-choc.jpg?v=1667346656Maxine's New in_stock 41.95 AUD 36.00 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Chocolate 32500532838500 4795267219556burncookiesboxof12cookiesncream Maxine's BURN Cookies - Box of 12 - Cookies 'N Cream Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you get lean and strong. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients, They are the ideal fat stripping snack. https://maxinesburn.com/products/burn-cookie?variant=32500532838500https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-cookies-box-of-12-cookies-and-cream.jpg?v=1667346656Maxine's New in_stock 41.95 AUD 36.00 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Cookies 'N Cream 32500532740196 4795267219556burncookiesindividualcookiechocolate Maxine's BURN Cookies - Individual Cookie - Chocolate Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you get lean and strong. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients, They are the ideal fat stripping snack. https://maxinesburn.com/products/burn-cookie?variant=32500532740196https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Burn-Cookie-Double-Choc.png?v=1667346656Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Chocolate 32500532772964 4795267219556burncookiesindividualcookiecookiesncream Maxine's BURN Cookies - Individual Cookie - Cookies 'N Cream Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you get lean and strong. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients, They are the ideal fat stripping snack. https://maxinesburn.com/products/burn-cookie?variant=32500532772964https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Burn-Cookie-cookies_cream.png?v=1667346656Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Cookies 'N Cream 41056097566820 4795267219556burncookiesboxof12choccaramelcrunch Maxine's BURN Cookies - Box of 12 - Choc Caramel Crunch Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you get lean and strong. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients, They are the ideal fat stripping snack. https://maxinesburn.com/products/burn-cookie?variant=41056097566820https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Choc-Caramel-Crunch-Cookie-Box-W-Cookie.png?v=1667346656Maxine's New in_stock 41.95 AUD 36.00 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Caramel Crunch 41056228081764 4795267219556burncookiesboxof12chocolatemacaroon Maxine's BURN Cookies - Box of 12 - Chocolate Macaroon Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you get lean and strong. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients, They are the ideal fat stripping snack. https://maxinesburn.com/products/burn-cookie?variant=41056228081764https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Chocolate-Macaroon-Cookie-Box-W-Cookies.png?v=1667346656Maxine's New in_stock 41.95 AUD 36.00 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Chocolate Macaroon 41056785956964 4795267219556burncookiesindividualcookiechoccaramelcrunch Maxine's BURN Cookies - Individual Cookie - Choc Caramel Crunch Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you get lean and strong. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients, They are the ideal fat stripping snack. https://maxinesburn.com/products/burn-cookie?variant=41056785956964https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Choc-Caramel-Crunch-Cookie-Front.png?v=1667356986Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Choc Caramel Crunch 41056806600804 4795267219556burncookiesindividualcookiechocolatemacaroon Maxine's BURN Cookies - Individual Cookie - Chocolate Macaroon Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you get lean and strong. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients, They are the ideal fat stripping snack. https://maxinesburn.com/products/burn-cookie?variant=41056806600804https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Chocolate-Macaroon-Cookie-Front.png?v=1667357265Maxine's New in_stock 3.95 AUD 3.50 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Chocolate Macaroon 32880069279844 4836907876452sipnburn30serves300gfruityfrost Maxine's Sip N' Burn - 30 Serves (300g) - Fruity Frost Do you need more energy and focus to get you through the day? Do you want to lift your output in the gym? Do you need help to recover better after tough workouts? Are you working at building that lean and toned look? If your answer is yes to any of these questions then Maxine's SIP'N BURN is for you! Maxine’s SIP’https://maxinesburn.com/products/sip-n-burn?variant=32880069279844https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Fruity-Frost-Front.png?v=1668059135Maxine's New in_stock 54.95 AUD 44.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Fruity Frost https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-LHS.png?v=1668059131https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-RHS.png?v=1668059131 32880069312612 4836907876452sipnburn30serves300ggoinggrape Maxine's Sip N' Burn - 30 Serves (300g) - Going Grape Do you need more energy and focus to get you through the day? Do you want to lift your output in the gym? Do you need help to recover better after tough workouts? Are you working at building that lean and toned look? If your answer is yes to any of these questions then Maxine's SIP'N BURN is for you! Maxine’s SIP’https://maxinesburn.com/products/sip-n-burn?variant=32880069312612https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-Front.png?v=1668059135Maxine's New in_stock 54.95 AUD 44.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Going Grape https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-LHS.png?v=1668059131https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-RHS.png?v=1668059131 32880069345380 4836907909220creaburn30serves300gcolacrush Maxine's Crea BURN - 30 Serves (300g) - Cola Crush Creatine is the most effective and widely researched supplement available for improving body composition and performance. Why?? Because it works amazingly well! Every athlete, weekend warrior, and gym goer should be using it. What does Creatine do? Put simply, Creatine increases your ability to train or compete harhttps://maxinesburn.com/products/creaburn?variant=32880069345380https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-Front.png?v=1668059056Maxine's New in_stock 56.95 AUD 47.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Cola Crush https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-LHS.png?v=1668059059https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-RHS.png?v=1668059059 32880069378148 4836907909220creaburn30serves300ggrapesplash Maxine's Crea BURN - 30 Serves (300g) - Grape Splash Creatine is the most effective and widely researched supplement available for improving body composition and performance. Why?? Because it works amazingly well! Every athlete, weekend warrior, and gym goer should be using it. What does Creatine do? Put simply, Creatine increases your ability to train or compete harhttps://maxinesburn.com/products/creaburn?variant=32880069378148https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Grape-Splash-Front.png?v=1668059059Maxine's New in_stock 56.95 AUD 47.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Grape Splash https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-LHS.png?v=1668059059https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-RHS.png?v=1668059059 4864133693540 vibrantMaxine's VIBRANT - 25 Serves (100 Capsules) Maxine’s VIBRANT is a female hormone balance formula designed to promote healthy estrogen levels whilst supporting vitality, mood and energy. This all natural combination of DIM (Diindolylmethane), Panax Ginseng and Maca Root will help keep you happy, healthy and vibrant every day!https://maxinesburn.com/products/vibrant https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Vibrant-Front.png?v=1605228870 Maxine's New in_stock49.95 AUD 39.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Workout Performance 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayhttps://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Vibrant-LHS.png?v=1605228871https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Vibrant-RHS.png?v=1605228871 4836908007524 cla-conjugated-linoleic-acidMaxine's CLA - Conjugated Linoleic Acid - 50 Serves (100 Capsules) Maxine’s CLA is pure Conjugated Linoleic Acid, a proven fat metaboliser, in an effectively dosed serving. Take Maxine’s CLA daily to support enhanced fat metabolism for a lean, strong and healthy body.https://maxinesburn.com/products/cla-conjugated-linoleic-acid https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-CLA-web.png?v=1600643455 Maxine's New in_stock39.95 AUD 29.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Fat Burners 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 32943463465060 4820381007972maxinesbeginnerburnpackchocfudgebrowniechocolatemousse Maxine's Beginner Burn Pack - Choc Fudge Brownie - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463465060https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse 32943463596132 4820381007972maxinesbeginnerburnpackchocfudgebrownievanilladream Maxine's Beginner Burn Pack - Choc Fudge Brownie - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463596132https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream 40247901225060 4820381007972maxinesbeginnerburnpackchocfudgebrowniesaltedcaramel Maxine's Beginner Burn Pack - Choc Fudge Brownie - Salted Caramel Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=40247901225060https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Salted Caramel 32943463727204 4820381007972maxinesbeginnerburnpackvanillaicecreamchocolatemousse Maxine's Beginner Burn Pack - Vanilla Ice Cream - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463727204https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse 32943463858276 4820381007972maxinesbeginnerburnpackvanillaicecreamvanilladream Maxine's Beginner Burn Pack - Vanilla Ice Cream - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463858276https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream 40247901257828 4820381007972maxinesbeginnerburnpackvanillaicecreamsaltedcaramel Maxine's Beginner Burn Pack - Vanilla Ice Cream - Salted Caramel Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=40247901257828https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Salted Caramel 32943463989348 4820381007972maxinesbeginnerburnpackchocolatehoneycombchocolatemousse Maxine's Beginner Burn Pack - Chocolate Honeycomb - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943463989348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse 32943464120420 4820381007972maxinesbeginnerburnpackchocolatehoneycombvanilladream Maxine's Beginner Burn Pack - Chocolate Honeycomb - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464120420https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream 40247901290596 4820381007972maxinesbeginnerburnpackchocolatehoneycombsaltedcaramel Maxine's Beginner Burn Pack - Chocolate Honeycomb - Salted Caramel Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=40247901290596https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Salted Caramel 32943464251492 4820381007972maxinesbeginnerburnpacksaltedcaramelchocolatemousse Maxine's Beginner Burn Pack - Salted Caramel - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464251492https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse 32943464382564 4820381007972maxinesbeginnerburnpacksaltedcaramelvanilladream Maxine's Beginner Burn Pack - Salted Caramel - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464382564https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream 40247901323364 4820381007972maxinesbeginnerburnpacksaltedcaramelsaltedcaramel Maxine's Beginner Burn Pack - Salted Caramel - Salted Caramel Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=40247901323364https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Salted Caramel 32943464513636 4820381007972maxinesbeginnerburnpackberrycheesecakechocolatemousse Maxine's Beginner Burn Pack - Berry Cheesecake - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464513636https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse 32943464644708 4820381007972maxinesbeginnerburnpackberrycheesecakevanilladream Maxine's Beginner Burn Pack - Berry Cheesecake - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=32943464644708https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream 40247901356132 4820381007972maxinesbeginnerburnpackberrycheesecakesaltedcaramel Maxine's Beginner Burn Pack - Berry Cheesecake - Salted Caramel Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=40247901356132https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Salted Caramel 40248008179812 4820381007972maxinesbeginnerburnpackicedmochaccinochocolatemousse Maxine's Beginner Burn Pack - Iced Mochaccino - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=40248008179812https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Chocolate Mousse 40248008212580 4820381007972maxinesbeginnerburnpackicedmochaccinovanilladream Maxine's Beginner Burn Pack - Iced Mochaccino - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=40248008212580https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Vanilla Dream 40248008245348 4820381007972maxinesbeginnerburnpackicedmochaccinosaltedcaramel Maxine's Beginner Burn Pack - Iced Mochaccino - Salted Caramel Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-beginner-pack?variant=40248008245348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Pack-1-Beginner.png?v=1654770818Maxine's New in_stock 88.40 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Salted Caramel 32943516123236 4820382285924intermediateburnpackchocfudgebrowniechocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Choc Fudge Brownie - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516123236https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Fruity Frost 32943516156004 4820382285924intermediateburnpackchocfudgebrowniechocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Choc Fudge Brownie - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516156004https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Going Grape 32943516188772 4820382285924intermediateburnpackchocfudgebrownievanilladreamfruityfrost Maxine's Intermediate Burn Pack - Choc Fudge Brownie - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516188772https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Fruity Frost 32943516221540 4820382285924intermediateburnpackchocfudgebrownievanilladreamgoinggrape Maxine's Intermediate Burn Pack - Choc Fudge Brownie - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516221540https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Going Grape 32943516254308 4820382285924intermediateburnpackvanillaicecreamchocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Vanilla Ice Cream - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516254308https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Fruity Frost 32943516287076 4820382285924intermediateburnpackvanillaicecreamchocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Vanilla Ice Cream - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516287076https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Going Grape 32943516319844 4820382285924intermediateburnpackvanillaicecreamvanilladreamfruityfrost Maxine's Intermediate Burn Pack - Vanilla Ice Cream - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516319844https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Fruity Frost 32943516352612 4820382285924intermediateburnpackvanillaicecreamvanilladreamgoinggrape Maxine's Intermediate Burn Pack - Vanilla Ice Cream - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516352612https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Going Grape 32943516385380 4820382285924intermediateburnpackchocolatehoneycombchocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Chocolate Honeycomb - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516385380https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse Fruity Frost 32943516418148 4820382285924intermediateburnpackchocolatehoneycombchocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Chocolate Honeycomb - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516418148https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse Going Grape 32943516450916 4820382285924intermediateburnpackchocolatehoneycombvanilladreamfruityfrost Maxine's Intermediate Burn Pack - Chocolate Honeycomb - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516450916https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream Fruity Frost 32943516483684 4820382285924intermediateburnpackchocolatehoneycombvanilladreamgoinggrape Maxine's Intermediate Burn Pack - Chocolate Honeycomb - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516483684https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream Going Grape 32943516516452 4820382285924intermediateburnpacksaltedcaramelchocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Salted Caramel - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516516452https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse Fruity Frost 32943516549220 4820382285924intermediateburnpacksaltedcaramelchocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Salted Caramel - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516549220https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse Going Grape 32943516581988 4820382285924intermediateburnpacksaltedcaramelvanilladreamfruityfrost Maxine's Intermediate Burn Pack - Salted Caramel - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516581988https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream Fruity Frost 32943516614756 4820382285924intermediateburnpacksaltedcaramelvanilladreamgoinggrape Maxine's Intermediate Burn Pack - Salted Caramel - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516614756https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream Going Grape 32943516647524 4820382285924intermediateburnpackberrycheesecakechocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Berry Cheesecake - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516647524https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse Fruity Frost 32943516680292 4820382285924intermediateburnpackberrycheesecakechocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Berry Cheesecake - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516680292https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse Going Grape 32943516713060 4820382285924intermediateburnpackberrycheesecakevanilladreamfruityfrost Maxine's Intermediate Burn Pack - Berry Cheesecake - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516713060https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream Fruity Frost 32943516745828 4820382285924intermediateburnpackberrycheesecakevanilladreamgoinggrape Maxine's Intermediate Burn Pack - Berry Cheesecake - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-intermediate-pack?variant=32943516745828https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxine_s-Intermediate.png?v=1597809712Maxine's New in_stock 215.90 AUD 185.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream Going Grape 32943555477604 4820382351460advancedburnpackchocfudgebrowniechocolatemoussefruityfrost Maxine's Advanced Burn Pack - Choc Fudge Brownie - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555477604https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-advanced-pack.png?v=1629250360Maxine's New in_stock 334.95 AUD 275.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Fruity Frost 32943555510372 4820382351460advancedburnpackchocfudgebrowniechocolatemoussegoinggrape Maxine's Advanced Burn Pack - Choc Fudge Brownie - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555510372https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-advanced-pack.png?v=1629250360Maxine's New in_stock 334.95 AUD 275.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Going Grape 32943555543140 4820382351460advancedburnpackchocfudgebrownievanilladreamfruityfrost Maxine's Advanced Burn Pack - Choc Fudge Brownie - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555543140https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-advanced-pack.png?v=1629250360Maxine's New in_stock 334.95 AUD 275.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Fruity Frost 32943555575908 4820382351460advancedburnpackchocfudgebrownievanilladreamgoinggrape Maxine's Advanced Burn Pack - Choc Fudge Brownie - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555575908https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-advanced-pack.png?v=1629250360Maxine's New in_stock 334.95 AUD 275.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Going Grape 32943555608676 4820382351460advancedburnpackvanillaicecreamchocolatemoussefruityfrost Maxine's Advanced Burn Pack - Vanilla Ice Cream - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555608676https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-advanced-pack.png?v=1629250360Maxine's New in_stock 334.95 AUD 275.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Fruity Frost 32943555641444 4820382351460advancedburnpackvanillaicecreamchocolatemoussegoinggrape Maxine's Advanced Burn Pack - Vanilla Ice Cream - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555641444https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-advanced-pack.png?v=1629250360Maxine's New in_stock 334.95 AUD 275.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Going Grape 32943555674212 4820382351460advancedburnpackvanillaicecreamvanilladreamfruityfrost Maxine's Advanced Burn Pack - Vanilla Ice Cream - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555674212https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-advanced-pack.png?v=1629250360Maxine's New in_stock 334.95 AUD 275.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Fruity Frost 32943555706980 4820382351460advancedburnpackvanillaicecreamvanilladreamgoinggrape Maxine's Advanced Burn Pack - Vanilla Ice Cream - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/maxines-advanced-pack?variant=32943555706980https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-advanced-pack.png?v=1629250360Maxine's New in_stock 334.95 AUD 275.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Going Grape 32880246030436 4836918886500twinpackburnprotein20serves500gchocfudgebrowniechocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246030436https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Choc Fudge Brownie 32880246063204 4836918886500twinpackburnprotein20serves500gchocfudgebrownieberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246063204https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Berry Cheesecake 32880246095972 4836918886500twinpackburnprotein20serves500gchocfudgebrownievanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246095972https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Vanilla Ice Cream 32880246128740 4836918886500twinpackburnprotein20serves500gchocfudgebrowniechochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246128740https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Choc Honeycomb 32880246161508 4836918886500twinpackburnprotein20serves500gchocfudgebrowniesaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246161508https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Salted Caramel 32880246194276 4836918886500twinpackburnprotein20serves500gberrycheesecakechocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246194276https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Choc Fudge Brownie 32880246227044 4836918886500twinpackburnprotein20serves500gberrycheesecakeberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246227044https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Berry Cheesecake 32880246259812 4836918886500twinpackburnprotein20serves500gberrycheesecakevanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246259812https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Vanilla Ice Cream 32880246292580 4836918886500twinpackburnprotein20serves500gberrycheesecakechochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246292580https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Choc Honeycomb 32880246325348 4836918886500twinpackburnprotein20serves500gberrycheesecakesaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246325348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Salted Caramel 32880246358116 4836918886500twinpackburnprotein20serves500gvanillaicecreamchocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246358116https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Choc Fudge Brownie 32880246390884 4836918886500twinpackburnprotein20serves500gvanillaicecreamberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246390884https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Berry Cheesecake 32880246423652 4836918886500twinpackburnprotein20serves500gvanillaicecreamvanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246423652https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Vanilla Ice Cream 32880246456420 4836918886500twinpackburnprotein20serves500gvanillaicecreamchochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246456420https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Choc Honeycomb 32880246489188 4836918886500twinpackburnprotein20serves500gvanillaicecreamsaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246489188https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Salted Caramel 32880246521956 4836918886500twinpackburnprotein20serves500gchochoneycombchocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246521956https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Choc Fudge Brownie 32880246554724 4836918886500twinpackburnprotein20serves500gchochoneycombberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246554724https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Berry Cheesecake 32880246587492 4836918886500twinpackburnprotein20serves500gchochoneycombvanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246587492https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Vanilla Ice Cream 32880246620260 4836918886500twinpackburnprotein20serves500gchochoneycombchochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246620260https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Choc Honeycomb 32880246653028 4836918886500twinpackburnprotein20serves500gchochoneycombsaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246653028https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Salted Caramel 32880246685796 4836918886500twinpackburnprotein20serves500gsaltedcaramelchocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246685796https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Choc Fudge Brownie 32880246718564 4836918886500twinpackburnprotein20serves500gsaltedcaramelberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246718564https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Berry Cheesecake 32880246751332 4836918886500twinpackburnprotein20serves500gsaltedcaramelvanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246751332https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Vanilla Ice Cream 32880246784100 4836918886500twinpackburnprotein20serves500gsaltedcaramelchochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246784100https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Choc Honeycomb 32880246816868 4836918886500twinpackburnprotein20serves500gsaltedcaramelsaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246816868https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 96.90 AUD 81.60 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Salted Caramel 32880246849636 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniechocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246849636https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Choc Fudge Brownie 32880246882404 4836918886500twinpackburnprotein50serves125kgchocfudgebrownieberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246882404https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Berry Cheesecake 32880246915172 4836918886500twinpackburnprotein50serves125kgchocfudgebrownievanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246915172https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Vanilla Ice Cream 32880246947940 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniechochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246947940https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Choc Honeycomb 32880246980708 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniesaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880246980708https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Salted Caramel 32880247013476 4836918886500twinpackburnprotein50serves125kgberrycheesecakechocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247013476https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Choc Fudge Brownie 32880247046244 4836918886500twinpackburnprotein50serves125kgberrycheesecakeberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247046244https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Berry Cheesecake 32880247079012 4836918886500twinpackburnprotein50serves125kgberrycheesecakevanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247079012https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Vanilla Ice Cream 32880247111780 4836918886500twinpackburnprotein50serves125kgberrycheesecakechochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247111780https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Choc Honeycomb 32880247144548 4836918886500twinpackburnprotein50serves125kgberrycheesecakesaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247144548https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Salted Caramel 32880247177316 4836918886500twinpackburnprotein50serves125kgvanillaicecreamchocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247177316https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Choc Fudge Brownie 32880247210084 4836918886500twinpackburnprotein50serves125kgvanillaicecreamberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247210084https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Berry Cheesecake 32880247242852 4836918886500twinpackburnprotein50serves125kgvanillaicecreamvanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247242852https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Vanilla Ice Cream 32880247275620 4836918886500twinpackburnprotein50serves125kgvanillaicecreamchochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247275620https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Choc Honeycomb 32880247308388 4836918886500twinpackburnprotein50serves125kgvanillaicecreamsaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247308388https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Salted Caramel 32880247341156 4836918886500twinpackburnprotein50serves125kgchochoneycombchocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247341156https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Choc Fudge Brownie 32880247373924 4836918886500twinpackburnprotein50serves125kgchochoneycombberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247373924https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Berry Cheesecake 32880247406692 4836918886500twinpackburnprotein50serves125kgchochoneycombvanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247406692https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Vanilla Ice Cream 32880247439460 4836918886500twinpackburnprotein50serves125kgchochoneycombchochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247439460https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Choc Honeycomb 32880247472228 4836918886500twinpackburnprotein50serves125kgchochoneycombsaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247472228https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Salted Caramel 32880247504996 4836918886500twinpackburnprotein50serves125kgsaltedcaramelchocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247504996https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Choc Fudge Brownie 32880247537764 4836918886500twinpackburnprotein50serves125kgsaltedcaramelberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247537764https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Berry Cheesecake 32880247570532 4836918886500twinpackburnprotein50serves125kgsaltedcaramelvanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247570532https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Vanilla Ice Cream 32880247603300 4836918886500twinpackburnprotein50serves125kgsaltedcaramelchochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247603300https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Choc Honeycomb 32880247636068 4836918886500twinpackburnprotein50serves125kgsaltedcaramelsaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-burn?variant=32880247636068https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-twin-pack.png?v=1600650898Maxine's New in_stock 203.90 AUD 161.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Salted Caramel 32880256090212 4836918460516twinpacknightprotein20serves500gchocolatemoussechocolatemousse Twin Pack: Maxine's Night Protein - 20 Serves (500g) - Chocolate Mousse - Chocolate Mousse Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256090212https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 95.90 AUD 75.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse Chocolate Mousse 32880256122980 4836918460516twinpacknightprotein20serves500gchocolatemoussevanilladream Twin Pack: Maxine's Night Protein - 20 Serves (500g) - Chocolate Mousse - Vanilla Dream Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256122980https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 95.90 AUD 75.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse Vanilla Dream 32880256155748 4836918460516twinpacknightprotein20serves500gvanilladreamchocolatemousse Twin Pack: Maxine's Night Protein - 20 Serves (500g) - Vanilla Dream - Chocolate Mousse Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256155748https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 95.90 AUD 75.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream Chocolate Mousse 32880256188516 4836918460516twinpacknightprotein20serves500gvanilladreamvanilladream Twin Pack: Maxine's Night Protein - 20 Serves (500g) - Vanilla Dream - Vanilla Dream Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256188516https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 95.90 AUD 75.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream Vanilla Dream 32880256221284 4836918460516twinpacknightprotein40serves1kgchocolatemoussechocolatemousse Twin Pack: Maxine's Night Protein - 40 Serves (1kg) - Chocolate Mousse - Chocolate Mousse Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256221284https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 179.90 AUD 142.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse Chocolate Mousse 32880256254052 4836918460516twinpacknightprotein40serves1kgchocolatemoussevanilladream Twin Pack: Maxine's Night Protein - 40 Serves (1kg) - Chocolate Mousse - Vanilla Dream Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256254052https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 179.90 AUD 142.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse Vanilla Dream 32880256286820 4836918460516twinpacknightprotein40serves1kgvanilladreamchocolatemousse Twin Pack: Maxine's Night Protein - 40 Serves (1kg) - Vanilla Dream - Chocolate Mousse Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256286820https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 179.90 AUD 142.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream Chocolate Mousse 32880256319588 4836918460516twinpacknightprotein40serves1kgvanilladreamvanilladream Twin Pack: Maxine's Night Protein - 40 Serves (1kg) - Vanilla Dream - Vanilla Dream Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-night?variant=32880256319588https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-night-protein-twin-pack.png?v=1600650561Maxine's New in_stock 179.90 AUD 142.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream Vanilla Dream 32880265527396 4836919640164twinpackplantprotein16serves400gnaturalchocolatenaturalchocolate Twin Pack: Maxine's Plant Protein - 16 Serves (400g) - Natural Chocolate - Natural Chocolate Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265527396https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 79.95 AUD 62.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate Natural Chocolate 32880265560164 4836919640164twinpackplantprotein16serves400gnaturalchocolatevanillabean Twin Pack: Maxine's Plant Protein - 16 Serves (400g) - Natural Chocolate - Vanilla Bean Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265560164https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 79.95 AUD 62.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate Vanilla Bean 32880265592932 4836919640164twinpackplantprotein16serves400gvanillabeannaturalchocolate Twin Pack: Maxine's Plant Protein - 16 Serves (400g) - Vanilla Bean - Natural Chocolate Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265592932https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 79.95 AUD 62.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean Natural Chocolate 32880265625700 4836919640164twinpackplantprotein16serves400gvanillabeanvanillabean Twin Pack: Maxine's Plant Protein - 16 Serves (400g) - Vanilla Bean - Vanilla Bean Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265625700https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 79.95 AUD 62.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean Vanilla Bean 32880265658468 4836919640164twinpackplantprotein36serves908gnaturalchocolatenaturalchocolate Twin Pack: Maxine's Plant Protein - 36 Serves (908g) - Natural Chocolate - Natural Chocolate Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265658468https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 139.95 AUD 107.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate Natural Chocolate 32880265691236 4836919640164twinpackplantprotein36serves908gnaturalchocolatevanillabean Twin Pack: Maxine's Plant Protein - 36 Serves (908g) - Natural Chocolate - Vanilla Bean Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265691236https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 139.95 AUD 107.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate Vanilla Bean 32880265724004 4836919640164twinpackplantprotein36serves908gvanillabeannaturalchocolate Twin Pack: Maxine's Plant Protein - 36 Serves (908g) - Vanilla Bean - Natural Chocolate Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265724004https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 139.95 AUD 107.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean Natural Chocolate 32880265756772 4836919640164twinpackplantprotein36serves908gvanillabeanvanillabean Twin Pack: Maxine's Plant Protein - 36 Serves (908g) - Vanilla Bean - Vanilla Bean Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-maxines-plant-protein?variant=32880265756772https://cdn.shopify.com/s/files/1/0270/2917/6420/products/twin-pack-maxines-plant-protein.png?v=1600651191Maxine's New out_of_stock 139.95 AUD 107.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean Vanilla Bean 4836920557668 twin-pack-burn-barsTwin Pack: Maxine's Burn Bars - Double Choc Fudge Twin Pack: Maxine's Burn Bars. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-burn-bars https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-bar-twin-pack.png?v=1600659471 Maxine's New in_stock7.95 AUD 6.49 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Double Choc Fudge 4836920590436 twin-pack-burn-cookiesTwin Pack: Maxine's Burn Cookies - Chocolate Twin Pack: Maxine's Burn Cookies. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-burn-cookies https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-burn-cookie-twin-pack.png?v=1600659463 Maxine's New out_of_stock7.95 AUD 5.29 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate 32880269688932 4836919902308twinpacksipnburnfruityfrostfruityfrost Twin Pack: Maxine's Sip N' Burn - Fruity Frost - Fruity Frost Twin Pack: Maxine's Sip N' Burn. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-sip-n-burn?variant=32880269688932https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Twin-Pack-Front.png?v=1668059299Maxine's New in_stock 99.95 AUD 80.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Fruity Frost Fruity Frost https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Fruity-Frost-Front_f7c6b0e1-0d71-43e9-8990-3d984d42809f.png?v=1668059318https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-Front_f0dccf90-c823-4d37-a9b4-d97605bbe468.png?v=1668059318https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-LHS_6b796f8d-a561-4853-9d36-71a01e99658c.png?v=1668059319https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-RHS_a58258f1-07ee-4ce1-adc6-e98b1bc2a88e.png?v=1668059317 32880269721700 4836919902308twinpacksipnburnfruityfrostgoinggrape Twin Pack: Maxine's Sip N' Burn - Fruity Frost - Going Grape Twin Pack: Maxine's Sip N' Burn. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-sip-n-burn?variant=32880269721700https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Twin-Pack-Front.png?v=1668059299Maxine's New in_stock 99.95 AUD 80.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Fruity Frost Going Grape https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Fruity-Frost-Front_f7c6b0e1-0d71-43e9-8990-3d984d42809f.png?v=1668059318https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-Front_f0dccf90-c823-4d37-a9b4-d97605bbe468.png?v=1668059318https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-LHS_6b796f8d-a561-4853-9d36-71a01e99658c.png?v=1668059319https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-RHS_a58258f1-07ee-4ce1-adc6-e98b1bc2a88e.png?v=1668059317 32880269754468 4836919902308twinpacksipnburngoinggrapefruityfrost Twin Pack: Maxine's Sip N' Burn - Going Grape - Fruity Frost Twin Pack: Maxine's Sip N' Burn. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-sip-n-burn?variant=32880269754468https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Twin-Pack-Front.png?v=1668059299Maxine's New in_stock 99.95 AUD 80.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Going Grape Fruity Frost https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Fruity-Frost-Front_f7c6b0e1-0d71-43e9-8990-3d984d42809f.png?v=1668059318https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-Front_f0dccf90-c823-4d37-a9b4-d97605bbe468.png?v=1668059318https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-LHS_6b796f8d-a561-4853-9d36-71a01e99658c.png?v=1668059319https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-RHS_a58258f1-07ee-4ce1-adc6-e98b1bc2a88e.png?v=1668059317 32880269787236 4836919902308twinpacksipnburngoinggrapegoinggrape Twin Pack: Maxine's Sip N' Burn - Going Grape - Going Grape Twin Pack: Maxine's Sip N' Burn. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-sip-n-burn?variant=32880269787236https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Twin-Pack-Front.png?v=1668059299Maxine's New in_stock 99.95 AUD 80.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Going Grape Going Grape https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Fruity-Frost-Front_f7c6b0e1-0d71-43e9-8990-3d984d42809f.png?v=1668059318https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-Front_f0dccf90-c823-4d37-a9b4-d97605bbe468.png?v=1668059318https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-LHS_6b796f8d-a561-4853-9d36-71a01e99658c.png?v=1668059319https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Sip_N-Burn-Going-Grape-RHS_a58258f1-07ee-4ce1-adc6-e98b1bc2a88e.png?v=1668059317 32880274374756 4836920328292twinpackcreaburncolacrushcolacrush Twin Pack: Maxine's Crea BURN - Cola Crush - Cola Crush Twin Pack: Maxine's Crea BURN. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-creaburn?variant=32880274374756https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Twin-Pack-Front.png?v=1668059490Maxine's New in_stock 95.90 AUD 86.30 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cola Crush Cola Crush https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-Front_333e82cf-f8ba-4b77-852b-6696f4a6983c.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Grape-Splash-Front_7c08f3f9-8ff6-49e9-825c-1c68d961ac11.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-LHS_3bec0d5d-e7ac-426a-97a6-685e078f9101.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-RHS_f6c20cd6-f8a6-4974-a413-9d91f776237f.png?v=1668059490 32880274407524 4836920328292twinpackcreaburncolacrushgrapesplash Twin Pack: Maxine's Crea BURN - Cola Crush - Grape Splash Twin Pack: Maxine's Crea BURN. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-creaburn?variant=32880274407524https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Twin-Pack-Front.png?v=1668059490Maxine's New in_stock 95.90 AUD 86.30 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cola Crush Grape Splash https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-Front_333e82cf-f8ba-4b77-852b-6696f4a6983c.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Grape-Splash-Front_7c08f3f9-8ff6-49e9-825c-1c68d961ac11.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-LHS_3bec0d5d-e7ac-426a-97a6-685e078f9101.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-RHS_f6c20cd6-f8a6-4974-a413-9d91f776237f.png?v=1668059490 32880274440292 4836920328292twinpackcreaburngrapesplashcolacrush Twin Pack: Maxine's Crea BURN - Grape Splash - Cola Crush Twin Pack: Maxine's Crea BURN. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-creaburn?variant=32880274440292https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Twin-Pack-Front.png?v=1668059490Maxine's New in_stock 95.90 AUD 86.30 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Grape Splash Cola Crush https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-Front_333e82cf-f8ba-4b77-852b-6696f4a6983c.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Grape-Splash-Front_7c08f3f9-8ff6-49e9-825c-1c68d961ac11.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-LHS_3bec0d5d-e7ac-426a-97a6-685e078f9101.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-RHS_f6c20cd6-f8a6-4974-a413-9d91f776237f.png?v=1668059490 32880274473060 4836920328292twinpackcreaburngrapesplashgrapesplash Twin Pack: Maxine's Crea BURN - Grape Splash - Grape Splash Twin Pack: Maxine's Crea BURN. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/twin-pack-creaburn?variant=32880274473060https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Twin-Pack-Front.png?v=1668059490Maxine's New in_stock 95.90 AUD 86.30 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Grape Splash Grape Splash https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-Front_333e82cf-f8ba-4b77-852b-6696f4a6983c.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Grape-Splash-Front_7c08f3f9-8ff6-49e9-825c-1c68d961ac11.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-LHS_3bec0d5d-e7ac-426a-97a6-685e078f9101.png?v=1668059490https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Crea-Burn-Cola-Crush-RHS_f6c20cd6-f8a6-4974-a413-9d91f776237f.png?v=1668059490 4836920754276 twin-pack-cla-capsulesTwin Pack: Maxine's CLA Capsules https://maxinesburn.com/products/twin-pack-cla-capsules https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-cla-twin-pack.png?v=1600659456 Maxine's New in_stock79.95 AUD 53.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4816552198244 maxines-premium-shakerMaxine's Premium Shaker The Maxine's My-Bottle Shaker Bottle is the most advanced and health friendly shaker bottle on the market today helping you to produce the smoothest and most replenishing drink with minimal effort. The secure No-Spill lockable lid system ensures no spills whilst the wide pop top 'flip cap' offers an easy to use design https://maxinesburn.com/products/maxines-premium-shaker https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines_shaker.png?v=1596765488 Maxine's New in_stock19.95 AUD 14.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4816000516196 pink-training-singletMaxine's Pink Training Singlet - XS Made from 100% Australian cotton for breathability and comfort, this easy wear, easy care tank with your favorite pair of tights is suitable for a range of workouts such as Training outdoors or in the Gym. Logo: Women Who Lift - Maxine'shttps://maxinesburn.com/products/pink-training-singlet https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-i-can-racerback-pink.png?v=1596765569 Maxine's New in_stock34.95 AUD 29.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayXS 4816552132708 black-training-singletMaxine's Black Training Singlet - XS Made from 100% Australian cotton for breathability and comfort, this easy wear, easy care tank with your favorite pair of tights is suitable for a range of workouts such as Training outdoors or in the Gym. Logo: Women Who Lift - Maxine'shttps://maxinesburn.com/products/black-training-singlet https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-women-who-lift-racerback-black.png?v=1596765565 Maxine's New in_stock34.95 AUD 29.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayXS 4816552362084 maxines-training-t-shirtMaxine's Training T-Shirt - 6 The MAXINE'S Logo T-Shirt delivers lasting comfort with a soft cotton fabric. ✓ Rib crew neck with interior taping. ✓ MAXINE'S chest logo. ✓ Fabric: 100% cotton. ✓ Machine wash.https://maxinesburn.com/products/maxines-training-t-shirt https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines.top.png?v=1596765574 Maxine's New in_stock29.95 AUD 12.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay6 39295360729188 6539906187364burncustard16serves500gcreamyvanillagoodness Maxine's BURN Custard - 16 Serves (500g) - Creamy Vanilla Goodness https://maxinesburn.com/products/burn-custard?variant=39295360729188https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-1kg-Vanilla.png?v=1615851348Maxine's New in_stock 47.95 AUD 39.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Creamy Vanilla Goodness https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-LHS.png?v=1615851348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-RHS.png?v=1615851348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Choc.png?v=1615851348 39295360893028 6539906187364burncustard16serves500gwhippedchocolatedecadence Maxine's BURN Custard - 16 Serves (500g) - Whipped Chocolate Decadence https://maxinesburn.com/products/burn-custard?variant=39295360893028https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-1kg-Choc.png?v=1615851348Maxine's New in_stock 47.95 AUD 39.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Whipped Chocolate Decadence https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-LHS.png?v=1615851348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-RHS.png?v=1615851348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Choc.png?v=1615851348 39258441187428 6539906187364burncustard33serves1kgcreamyvanillagoodness Maxine's BURN Custard - 33 Serves (1kg) - Creamy Vanilla Goodness https://maxinesburn.com/products/burn-custard?variant=39258441187428https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-1kg-Vanilla.png?v=1615851348Maxine's New in_stock 89.95 AUD 74.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Creamy Vanilla Goodness https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-LHS.png?v=1615851348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-RHS.png?v=1615851348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Choc.png?v=1615851348 39258441154660 6539906187364burncustard33serves1kgwhippedchocolatedecadence Maxine's BURN Custard - 33 Serves (1kg) - Whipped Chocolate Decadence https://maxinesburn.com/products/burn-custard?variant=39258441154660https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-1kg-Choc.png?v=1615851348Maxine's New in_stock 89.95 AUD 74.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Whipped Chocolate Decadence https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-LHS.png?v=1615851348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-RHS.png?v=1615851348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Choc.png?v=1615851348 39265275281508 6542142636132twinpackburncustard16serves500gcreamyvanillagoodnesscreamyvanillagoodn Twin Pack: Maxine's BURN Custard - 16 Serves (500g) - Creamy Vanilla Goodness - Creamy Vanilla Goodness https://maxinesburn.com/products/twin-pack-burn-custard?variant=39265275281508https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla_7cf3ae61-43b2-470e-a7f9-79e29d1fbd44.png?v=1616129552Maxine's New in_stock 95.90 AUD 75.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Creamy Vanilla Goodness Creamy Vanilla Goodness 39265275314276 6542142636132twinpackburncustard16serves500gcreamyvanillagoodnesswhippedchocolatede Twin Pack: Maxine's BURN Custard - 16 Serves (500g) - Creamy Vanilla Goodness - Whipped Chocolate Decadence https://maxinesburn.com/products/twin-pack-burn-custard?variant=39265275314276https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-Chocolate.png?v=1616129552Maxine's New in_stock 95.90 AUD 75.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Creamy Vanilla Goodness Whipped Chocolate Decadence 39265275347044 6542142636132twinpackburncustard16serves500gwhippedchocolatedecadencecreamyvanillag Twin Pack: Maxine's BURN Custard - 16 Serves (500g) - Whipped Chocolate Decadence - Creamy Vanilla Goodness https://maxinesburn.com/products/twin-pack-burn-custard?variant=39265275347044https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Vanilla-Chocolate.png?v=1616129552Maxine's New in_stock 95.90 AUD 75.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Whipped Chocolate Decadence Creamy Vanilla Goodness 39265275379812 6542142636132twinpackburncustard16serves500gwhippedchocolatedecadencewhippedchocola Twin Pack: Maxine's BURN Custard - 16 Serves (500g) - Whipped Chocolate Decadence - Whipped Chocolate Decadence https://maxinesburn.com/products/twin-pack-burn-custard?variant=39265275379812https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Burn-Custard-500g-Chocolate.png?v=1616129580Maxine's New in_stock 95.90 AUD 75.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Whipped Chocolate Decadence Whipped Chocolate Decadence 39265275412580 6542142636132twinpackburncustard33serves1kgcreamyvanillagoodnesscreamyvanillagoodne Twin Pack: Maxine's BURN Custard - 33 Serves (1kg) - Creamy Vanilla Goodness - Creamy Vanilla Goodness https://maxinesburn.com/products/twin-pack-burn-custard?variant=39265275412580https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Twin-Pack-Maxines-Burn-Custard-1kg-Vanilla.png?v=1616129651Maxine's New in_stock 179.90 AUD 142.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Creamy Vanilla Goodness Creamy Vanilla Goodness 39265275445348 6542142636132twinpackburncustard33serves1kgcreamyvanillagoodnesswhippedchocolatedec Twin Pack: Maxine's BURN Custard - 33 Serves (1kg) - Creamy Vanilla Goodness - Whipped Chocolate Decadence https://maxinesburn.com/products/twin-pack-burn-custard?variant=39265275445348https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Twin-Pack-Maxines-Burn-Custard-1kg-Vanilla-Chocolate.png?v=1616129646Maxine's New in_stock 179.90 AUD 142.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Creamy Vanilla Goodness Whipped Chocolate Decadence 39265275478116 6542142636132twinpackburncustard33serves1kgwhippedchocolatedecadencecreamyvanillago Twin Pack: Maxine's BURN Custard - 33 Serves (1kg) - Whipped Chocolate Decadence - Creamy Vanilla Goodness https://maxinesburn.com/products/twin-pack-burn-custard?variant=39265275478116https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Twin-Pack-Maxines-Burn-Custard-1kg-Vanilla-Chocolate.png?v=1616129646Maxine's New in_stock 179.90 AUD 142.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Whipped Chocolate Decadence Creamy Vanilla Goodness 39265275510884 6542142636132twinpackburncustard33serves1kgwhippedchocolatedecadencewhippedchocolat Twin Pack: Maxine's BURN Custard - 33 Serves (1kg) - Whipped Chocolate Decadence - Whipped Chocolate Decadence https://maxinesburn.com/products/twin-pack-burn-custard?variant=39265275510884https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Twin-Pack-Maxines-Burn-Custard-1kg-Chocolate.png?v=1616129682Maxine's New in_stock 179.90 AUD 142.40 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Whipped Chocolate Decadence Whipped Chocolate Decadence 6546036850788 maxines-workout-bottleMaxine's Workout Bottle https://maxinesburn.com/products/maxines-workout-bottle https://cdn.shopify.com/s/files/1/0270/2917/6420/products/maxines-waterbottle.png?v=1616708014 Maxine's New in_stock24.95 AUD 19.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 39539511984228 6633857548388maxsbeginnershredtestbuildchocolatebrownierichchocolatemoussemyotcapsu Max's Beginner Shred Test Build - Chocolate Brownie - Rich Chocolate Mousse - MYO-T Capsules https://maxinesburn.com/products/maxs-beginner-shred-test-build?variant=39539511984228https://cdn.shopify.com/shopifycloud/shopify/assets/no-image-2048-5e88c1b20e087fb7bbe9a3771824e743c244f437e4f8ba93bbf7b11b53f7824c.gifMaxine's New out_of_stock AUD 129.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Brownie Rich Chocolate Mousse MYO-T Capsules 6647341842532 mct-capsulesMaxine's MCT Capsules - 100 Serves (100 Capsules) https://maxinesburn.com/products/mct-capsules https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-MCT-Front.png?v=1639351628 Maxine's New in_stock39.95 AUD 29.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayhttps://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-MCT-RHS.png?v=1639351661https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-MCT-LHS.png?v=1639351661 39837949001828 6731456184420melt60serves300gmouthwateringmelon Maxine's Melt - 60 Serves (300g) - Mouth Watering Melon MELT is a high potency Fat Burning matrix specifically designed to ignite your metabolism, boost energy and enhance focus and cognition so you have the extra edge to build a lean & toned body!https://maxinesburn.com/products/melt?variant=39837949001828https://cdn.shopify.com/s/files/1/0270/2917/6420/products/MELT-Mouth-Watering-Melon-Front.png?v=1646018844Maxine's New in_stock 82.95 AUD 74.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Fat Burners > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay60 Serves (300g) Mouth Watering Melon https://cdn.shopify.com/s/files/1/0270/2917/6420/products/MELT-Mouth-Watering-Melon-LHS.png?v=1646018844https://cdn.shopify.com/s/files/1/0270/2917/6420/products/MELT-Mouth-Watering-Melon-RHS.png?v=1646018844 39837949132900 6731456184420melt60serves300gnonstimkiwilimecrush Maxine's Melt - 60 Serves (300g) - (NON STIM) Kiwi Lime Crush MELT is a high potency Fat Burning matrix specifically designed to ignite your metabolism, boost energy and enhance focus and cognition so you have the extra edge to build a lean & toned body!https://maxinesburn.com/products/melt?variant=39837949132900https://cdn.shopify.com/s/files/1/0270/2917/6420/products/MELT-Kiwi-Lime-Crush-Front.png?v=1646018844Maxine's New in_stock 82.95 AUD 74.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Fat Burners > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay60 Serves (300g) (NON STIM) Kiwi Lime Crush https://cdn.shopify.com/s/files/1/0270/2917/6420/products/MELT-Mouth-Watering-Melon-LHS.png?v=1646018844https://cdn.shopify.com/s/files/1/0270/2917/6420/products/MELT-Mouth-Watering-Melon-RHS.png?v=1646018844 40247984095332 6860030640228burncustarddessertpackmchallengevanillaicecreamcreamyvanillagoodness10 Maxine's Burn & Custard Dessert Pack - M Challenge - Vanilla Ice Cream - Creamy Vanilla Goodness - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247984095332https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247984193636 6860030640228burncustarddessertpackmchallengevanillaicecreamwhippedchocolatedecaden Maxine's Burn & Custard Dessert Pack - M Challenge - Vanilla Ice Cream - Whipped Chocolate Decadence - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247984193636https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Whipped Chocolate Decadence 100 Serves (100 Capsules) 40247983603812 6860030640228burncustarddessertpackmchallengechocfudgebrowniecreamyvanillagoodness1 Maxine's Burn & Custard Dessert Pack - M Challenge - Choc Fudge Brownie - Creamy Vanilla Goodness - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247983603812https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247983702116 6860030640228burncustarddessertpackmchallengechocfudgebrowniewhippedchocolatedecade Maxine's Burn & Custard Dessert Pack - M Challenge - Choc Fudge Brownie - Whipped Chocolate Decadence - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247983702116https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Whipped Chocolate Decadence 100 Serves (100 Capsules) 40248033804388 6860030640228burncustarddessertpackmchallengeberrycheesecakecreamyvanillagoodness10 Maxine's Burn & Custard Dessert Pack - M Challenge - Berry Cheesecake - Creamy Vanilla Goodness - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40248033804388https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Creamy Vanilla Goodness 100 Serves (100 Capsules) 40248033837156 6860030640228burncustarddessertpackmchallengeberrycheesecakewhippedchocolatedecaden Maxine's Burn & Custard Dessert Pack - M Challenge - Berry Cheesecake - Whipped Chocolate Decadence - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40248033837156https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Whipped Chocolate Decadence 100 Serves (100 Capsules) 40247984619620 6860030640228burncustarddessertpackmchallengechochoneycombcreamyvanillagoodness100s Maxine's Burn & Custard Dessert Pack - M Challenge - Choc Honeycomb - Creamy Vanilla Goodness - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247984619620https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Honeycomb Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247984717924 6860030640228burncustarddessertpackmchallengechochoneycombwhippedchocolatedecadence Maxine's Burn & Custard Dessert Pack - M Challenge - Choc Honeycomb - Whipped Chocolate Decadence - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247984717924https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Honeycomb Whipped Chocolate Decadence 100 Serves (100 Capsules) 40247983112292 6860030640228burncustarddessertpackmchallengecookiescreamcreamyvanillagoodness100se Maxine's Burn & Custard Dessert Pack - M Challenge - Cookies & Cream - Creamy Vanilla Goodness - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247983112292https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cookies & Cream Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247983210596 6860030640228burncustarddessertpackmchallengecookiescreamwhippedchocolatedecadence1 Maxine's Burn & Custard Dessert Pack - M Challenge - Cookies & Cream - Whipped Chocolate Decadence - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247983210596https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cookies & Cream Whipped Chocolate Decadence 100 Serves (100 Capsules) 40247982620772 6860030640228burncustarddessertpackmchallengeicedmochaccinocreamyvanillagoodness100 Maxine's Burn & Custard Dessert Pack - M Challenge - Iced Mochaccino - Creamy Vanilla Goodness - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247982620772https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Creamy Vanilla Goodness 100 Serves (100 Capsules) 40247982719076 6860030640228burncustarddessertpackmchallengeicedmochaccinowhippedchocolatedecadenc Maxine's Burn & Custard Dessert Pack - M Challenge - Iced Mochaccino - Whipped Chocolate Decadence - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40247982719076https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Whipped Chocolate Decadence 100 Serves (100 Capsules) 40248052351076 6860030640228burncustarddessertpackmchallengesaltedcaramelcreamyvanillagoodness100s Maxine's Burn & Custard Dessert Pack - M Challenge - Salted Caramel - Creamy Vanilla Goodness - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40248052351076https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Creamy Vanilla Goodness 100 Serves (100 Capsules) 40248052383844 6860030640228burncustarddessertpackmchallengesaltedcaramelwhippedchocolatedecadence Maxine's Burn & Custard Dessert Pack - M Challenge - Salted Caramel - Whipped Chocolate Decadence - 100 Serves (100 Capsules) M Challenge Exclusive Burn & Custard value pack includes ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Custard✓ CLA 100 Serve Capsules (Free) Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/burn-custard-dessert-pack?variant=40248052383844https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Starter-Pack-2.png?v=1654772400Maxine's New in_stock 107.85 AUD 77.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Whipped Chocolate Decadence 100 Serves (100 Capsules) 40248085282916 6860068454500meltburnvaluepackmchallengevanillaicecreammouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge - Vanilla Ice Cream - Mouthwatering Melon - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085282916https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Mouthwatering Melon 25 Serves 40248085315684 6860068454500meltburnvaluepackmchallengevanillaicecreamkiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge - Vanilla Ice Cream - Kiwi Lime Crush (NON STIM) - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085315684https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Kiwi Lime Crush (NON STIM) 25 Serves 40248085348452 6860068454500meltburnvaluepackmchallengechocfudgebrowniemouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge - Choc Fudge Brownie - Mouthwatering Melon - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085348452https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Mouthwatering Melon 25 Serves 40248085381220 6860068454500meltburnvaluepackmchallengechocfudgebrowniekiwilimecrushnonstim25serve Maxine's Melt & Burn Value Pack - M Challenge - Choc Fudge Brownie - Kiwi Lime Crush (NON STIM) - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085381220https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Kiwi Lime Crush (NON STIM) 25 Serves 40248085413988 6860068454500meltburnvaluepackmchallengeberrycheesecakemouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge - Berry Cheesecake - Mouthwatering Melon - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085413988https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Mouthwatering Melon 25 Serves 40248085446756 6860068454500meltburnvaluepackmchallengeberrycheesecakekiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge - Berry Cheesecake - Kiwi Lime Crush (NON STIM) - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085446756https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Kiwi Lime Crush (NON STIM) 25 Serves 40248085479524 6860068454500meltburnvaluepackmchallengechochoneycombmouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge - Choc Honeycomb - Mouthwatering Melon - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085479524https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Honeycomb Mouthwatering Melon 25 Serves 40248085512292 6860068454500meltburnvaluepackmchallengechochoneycombkiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge - Choc Honeycomb - Kiwi Lime Crush (NON STIM) - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085512292https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Honeycomb Kiwi Lime Crush (NON STIM) 25 Serves 40248085545060 6860068454500meltburnvaluepackmchallengecookiescreammouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge - Cookies & Cream - Mouthwatering Melon - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085545060https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cookies & Cream Mouthwatering Melon 25 Serves 40248085577828 6860068454500meltburnvaluepackmchallengecookiescreamkiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge - Cookies & Cream - Kiwi Lime Crush (NON STIM) - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085577828https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cookies & Cream Kiwi Lime Crush (NON STIM) 25 Serves 40248085610596 6860068454500meltburnvaluepackmchallengeicedmochaccinomouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge - Iced Mochaccino - Mouthwatering Melon - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085610596https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Mouthwatering Melon 25 Serves 40248085643364 6860068454500meltburnvaluepackmchallengeicedmochaccinokiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge - Iced Mochaccino - Kiwi Lime Crush (NON STIM) - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085643364https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Iced Mochaccino Kiwi Lime Crush (NON STIM) 25 Serves 40248085676132 6860068454500meltburnvaluepackmchallengesaltedcaramelmouthwateringmelon25serves Maxine's Melt & Burn Value Pack - M Challenge - Salted Caramel - Mouthwatering Melon - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085676132https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Mouthwatering Melon 25 Serves 40248085708900 6860068454500meltburnvaluepackmchallengesaltedcaramelkiwilimecrushnonstim25serves Maxine's Melt & Burn Value Pack - M Challenge - Salted Caramel - Kiwi Lime Crush (NON STIM) - 25 Serves M Challenge Exclusive Melt & Burn value pack includes ✓ 500g Maxine’s Burn ✓ 300g Maxine’s Melt Thermogenic Heaven ✓ FREE Vibrant 25 Serve Capsules - Order today for a discounted price and guaranteed fast shipping!https://maxinesburn.com/products/melt-burn-value-pack-1?variant=40248085708900https://cdn.shopify.com/s/files/1/0270/2917/6420/products/M-Challenge-Burn-Advanced-Pack.png?v=1654773705Maxine's New in_stock 184.85 AUD 144.90 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 0 AUD > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Kiwi Lime Crush (NON STIM) 25 Serves 7024049094756 maxines-creatine-capsulesMaxine's Creatine Capsules - 25 Serves (100 Capsules) Maxine’s Creatine Capsules are made with pure Creatine Monohydrate with no added flavours or sweeteners. Creatine is one of the most studied and widely taken supplements that is known to help enhance natural energy and power whilst supporting lean muscle growth to help build a toned body - Shop Now!https://maxinesburn.com/products/maxines-creatine-capsules https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Creatine-Capsules-Front.png?v=1667954167 Maxine's New in_stock29.95 AUD 24.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Workout Performance 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayhttps://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Creatine-Capsules-LHS.png?v=1667954166https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Creatine-Capsules-RHS.png?v=1667954167 7024061710436 maxines-apple-cider-gummiesMaxine's Apple Cider Gummies - 60 Serves (60 Gummies) Maxine’s Apple Cider Gummies are the perfect addition to your daily health & wellness regime! Apple Cider Vinegar has a host of amazing health benefits and has been widely used to help promote a lean and toned body. Use our Apple Cider Gummies daily to experience the full benefits! - Shop Now!https://maxinesburn.com/products/maxines-apple-cider-gummies https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Apple-Cider-Vinegar-Capsules-Front.png?v=1667955863 Maxine's New in_stock24.95 AUD 19.95 AUD 2023-03-24T00:25:50+1100/2023-04-22T23:25:50+1000 AU Standard 9.95 AUD Workout Performance 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayhttps://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Apple-Cider-Vinegar-Capsules-LHS.png?v=1667955863https://cdn.shopify.com/s/files/1/0270/2917/6420/products/Maxines-Apple-Cider-Vinegar-Capsules-RHS.png?v=1667955863