Maxine's Burn Maxine’s is Australian Made & Australian Owned Quality Supplements. Protein, Bars, Fat Burning, Weight Loss. 32500489388132 4795266400356burn20serves500gchocfudgebrownie Maxine's BURN - 20 Serves (500g) - Choc Fudge Brownie ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie 32500489420900 4795266400356burn20serves500gberrycheesecake Maxine's BURN - 20 Serves (500g) - Berry Cheesecake ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake 32500489453668 4795266400356burn20serves500gvanillaicecream Maxine's BURN - 20 Serves (500g) - Vanilla Ice Cream ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream 32500489486436 4795266400356burn20serves500gchochoneycomb Maxine's BURN - 20 Serves (500g) - Choc Honeycomb ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb 32500489519204 4795266400356burn20serves500gsaltedcaramel Maxine's BURN - 20 Serves (500g) - Salted Caramel ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel 32500489551972 4795266400356burn50serves125kgchocfudgebrownie Maxine's BURN - 50 Serves (1.25kg) - Choc Fudge Brownie ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie 32500489584740 4795266400356burn50serves125kgberrycheesecake Maxine's BURN - 50 Serves (1.25kg) - Berry Cheesecake ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake 32500489617508 4795266400356burn50serves125kgvanillaicecream Maxine's BURN - 50 Serves (1.25kg) - Vanilla Ice Cream ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream 32500489650276 4795266400356burn50serves125kgchochoneycomb Maxine's BURN - 50 Serves (1.25kg) - Choc Honeycomb ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb 32500489683044 4795266400356burn50serves125kgsaltedcaramel Maxine's BURN - 50 Serves (1.25kg) - Salted Caramel ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel 32605988225124 4795266400356burn90serves22kgchocfudgebrownie Maxine's BURN - 90 Serves (2.2kg) - Choc Fudge Brownie ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 109.95 AUD 99.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Choc Fudge Brownie 32605988388964 4795266400356burn90serves22kgvanillaicecream Maxine's BURN - 90 Serves (2.2kg) - Vanilla Ice Cream ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 109.95 AUD 99.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Vanilla Ice Cream 33061980569700 4795266400356burn90serves22kgberrycheesecake Maxine's BURN - 90 Serves (2.2kg) - Berry Cheesecake ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New out_of_stock 109.95 AUD 99.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Berry Cheesecake 33061980831844 4795266400356burn90serves22kgchochoneycomb Maxine's BURN - 90 Serves (2.2kg) - Choc Honeycomb ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 109.95 AUD 99.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Choc Honeycomb 33061980864612 4795266400356burn90serves22kgsaltedcaramel Maxine's BURN - 90 Serves (2.2kg) - Salted Caramel ALL NEW Maxine’s BURN is the ideal addition to your busy lifestyle. Our high protein fat burning formula is designed to help you look and feel great. Maxine’s BURN is low in carbs, fats and sugar, and enhanced with natural fat burning nutrients to increase your metabolism, burn stubborn fat and help build or mainta's New in_stock 109.95 AUD 99.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay90 Serves (2.2kg) Salted Caramel 32500491190372 4795266531428night20serves500gchocolatemousse Maxine's NIGHT - 20 Serves (500g) - Chocolate Mousse All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle,'s New out_of_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse 32500491223140 4795266531428night20serves500gvanilladream Maxine's NIGHT - 20 Serves (500g) - Vanilla Dream All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle,'s New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream 32500491255908 4795266531428night40serves1kgchocolatemousse Maxine's NIGHT - 40 Serves (1kg) - Chocolate Mousse All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle,'s New in_stock 59.95 AUD 49.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse 32500491288676 4795266531428night40serves1kgvanilladream Maxine's NIGHT - 40 Serves (1kg) - Vanilla Dream All NEW Maxine’s NIGHT is formulated to help tone your body and burn fat while you sleep. Our unique slow release protein blend will also replenish your energy reserves and maximise your recovery. If you do regular exercise like weight training or cardio, play sport, or you simply live an active and busy lifestyle,'s New in_stock 59.95 AUD 49.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream 32500550140004 4795266596964plantprotein16serves400gnaturalchocolate Maxine's Plant Protein - 16 Serves (400g) - Natural Chocolate Maxine's Plant protein is a 100% Pure, Natural, non-GMO Organic Plant Protein formulated to build, repair and tone lean muscle and optimise your energy and health. Maxine's Plant Protein contains nothing artificial. It is high in protein and low in carbohydrates and sugar. It also contains natural plant extracts th's New in_stock 39.95 AUD 34.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate 32500550172772 4795266596964plantprotein16serves400gvanillabean Maxine's Plant Protein - 16 Serves (400g) - Vanilla Bean Maxine's Plant protein is a 100% Pure, Natural, non-GMO Organic Plant Protein formulated to build, repair and tone lean muscle and optimise your energy and health. Maxine's Plant Protein contains nothing artificial. It is high in protein and low in carbohydrates and sugar. It also contains natural plant extracts th's New in_stock 39.95 AUD 34.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean 32500550205540 4795266596964plantprotein36serves908gnaturalchocolate Maxine's Plant Protein - 36 Serves (908g) - Natural Chocolate Maxine's Plant protein is a 100% Pure, Natural, non-GMO Organic Plant Protein formulated to build, repair and tone lean muscle and optimise your energy and health. Maxine's Plant Protein contains nothing artificial. It is high in protein and low in carbohydrates and sugar. It also contains natural plant extracts th's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate 32500550238308 4795266596964plantprotein36serves908gvanillabean Maxine's Plant Protein - 36 Serves (908g) - Vanilla Bean Maxine's Plant protein is a 100% Pure, Natural, non-GMO Organic Plant Protein formulated to build, repair and tone lean muscle and optimise your energy and health. Maxine's Plant Protein contains nothing artificial. It is high in protein and low in carbohydrates and sugar. It also contains natural plant extracts th's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean 32868512039012 4832130760804burnbarsboxof12choccaramelcrunch Maxine's Burn Bars - Box of 12 - Choc Caramel Crunch Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Caramel Crunch 32868512071780 4832130760804burnbarsboxof12doublechocfudge Maxine's Burn Bars - Box of 12 - Double Choc Fudge Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Double Choc Fudge 32868512104548 4832130760804burnbarsboxof12cookiescream Maxine's Burn Bars - Box of 12 - Cookies & Cream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Cookies & Cream 32868512137316 4832130760804burnbarsboxof12chocmocha Maxine's Burn Bars - Box of 12 - Choc Mocha Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Mocha 32868512170084 4832130760804burnbarsboxof12chocmintfudge Maxine's Burn Bars - Box of 12 - Choc Mint Fudge Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New out_of_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Choc Mint Fudge 32868512006244 4832130760804burnbarsboxof12coconutdream Maxine's Burn Bars - Box of 12 - Coconut Dream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New out_of_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Coconut Dream 32868511973476 4832130760804burnbarsboxof12hazelnutheaven Maxine's Burn Bars - Box of 12 - Hazelnut Heaven Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Hazelnut Heaven 32868512202852 4832130760804burnbarsboxof12redvelvetcupcake Maxine's Burn Bars - Box of 12 - Red Velvet Cupcake Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New out_of_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Red Velvet Cupcake 32868512235620 4832130760804burnbarsboxof12whitechocraspberry Maxine's Burn Bars - Box of 12 - White Choc Raspberry Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New out_of_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 White Choc Raspberry 32868512268388 4832130760804burnbarsboxof12mangococonutcream Maxine's Burn Bars - Box of 12 - Mango Coconut Cream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Mango Coconut Cream 32868512301156 4832130760804burnbarsboxof12berrydelight Maxine's Burn Bars - Box of 12 - Berry Delight Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Berry Delight 32868512333924 4832130760804burnbarsindividualbarchoccaramelcrunch Maxine's Burn Bars - Individual Bar - Choc Caramel Crunch Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Caramel Crunch 32868512366692 4832130760804burnbarsindividualbardoublechocfudge Maxine's Burn Bars - Individual Bar - Double Choc Fudge Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Double Choc Fudge 32868512399460 4832130760804burnbarsindividualbarcookiescream Maxine's Burn Bars - Individual Bar - Cookies & Cream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Cookies & Cream 32868512432228 4832130760804burnbarsindividualbarchocmocha Maxine's Burn Bars - Individual Bar - Choc Mocha Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Mocha 32868512464996 4832130760804burnbarsindividualbarchocmintfudge Maxine's Burn Bars - Individual Bar - Choc Mint Fudge Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New out_of_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Choc Mint Fudge 32868512628836 4832130760804burnbarsindividualbarcoconutdream Maxine's Burn Bars - Individual Bar - Coconut Dream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New out_of_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Coconut Dream 32868512661604 4832130760804burnbarsindividualbarhazelnutheaven Maxine's Burn Bars - Individual Bar - Hazelnut Heaven Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Hazelnut Heaven 32868512497764 4832130760804burnbarsindividualbarredvelvetcupcake Maxine's Burn Bars - Individual Bar - Red Velvet Cupcake Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New out_of_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Red Velvet Cupcake 32868512530532 4832130760804burnbarsindividualbarwhitechocraspberry Maxine's Burn Bars - Individual Bar - White Choc Raspberry Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New out_of_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar White Choc Raspberry 32868512563300 4832130760804burnbarsindividualbarmangococonutcream Maxine's Burn Bars - Individual Bar - Mango Coconut Cream Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Mango Coconut Cream 32868512596068 4832130760804burnbarsindividualbarberrydelight Maxine's Burn Bars - Individual Bar - Berry Delight Maxine’s BURN bars are the ideal high protein snack for active women. They are low in fat and carbohydrates, and have a unique thermogenic protein blend and contain powerful carb blockers and fat burners to really ignite your metabolism.They are a delicious guilt-free treat perfect for all women.'s New in_stock 3.95 AUD 2.99 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Bar Berry Delight 32500532805732 4795267219556burncookiesboxof12chocolate Maxine's BURN Cookies - Box of 12 - Chocolate Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you burn fat. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients it makes for the ultimate fat stripping snack. It is a's New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Chocolate 32500532838500 4795267219556burncookiesboxof12cookiesncream Maxine's BURN Cookies - Box of 12 - Cookies 'N Cream Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you burn fat. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients it makes for the ultimate fat stripping snack. It is a's New in_stock 39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayBox of 12 Cookies 'N Cream 32500532740196 4795267219556burncookiesindividualcookiechocolate Maxine's BURN Cookies - Individual Cookie - Chocolate Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you burn fat. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients it makes for the ultimate fat stripping snack. It is a's New in_stock 3.95 AUD 2.49 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Chocolate 32500532772964 4795267219556burncookiesindividualcookiecookiesncream Maxine's BURN Cookies - Individual Cookie - Cookies 'N Cream Maxine’s BURN Cookies are high in protein yet low in carbohydrate and fat, and have a unique thermogenic formula that help you burn fat. The high quality protein blend helps you feel fuller for longer, and combined with carb blocking and fat burning ingredients it makes for the ultimate fat stripping snack. It is a's New in_stock 3.95 AUD 2.49 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Snacks > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayIndividual Cookie Cookies 'N Cream 32880069279844 4836907876452sipnburn30serves300gfruityfrost Maxine's Sip N' Burn - 30 Serves (300g) - Fruity Frost Do you need more energy and focus to get you through the day? Do you want to lift your output in the gym? Do you need help to recover better after tough workouts? Are you working at building that lean and toned look? If your answer is yes to any of these questions then Maxine's SIP'N BURN is for you! Maxine’s SIP’'s New in_stock 49.95 AUD 39.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Fruity Frost 32880069312612 4836907876452sipnburn30serves300ggoinggrape Maxine's Sip N' Burn - 30 Serves (300g) - Going Grape Do you need more energy and focus to get you through the day? Do you want to lift your output in the gym? Do you need help to recover better after tough workouts? Are you working at building that lean and toned look? If your answer is yes to any of these questions then Maxine's SIP'N BURN is for you! Maxine’s SIP’'s New in_stock 49.95 AUD 39.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Going Grape 32880069345380 4836907909220creaburn30serves300gcolacrush Maxine's Crea BURN - 30 Serves (300g) - Cola Crush Creatine is the most effective and widely researched supplement available for improving body composition and performance. Why?? Because it works amazingly well! Every athlete, weekend warrior, and gym goer should be using it. What does Creatine do? Put simply, Creatine increases your ability to train or compete har's New in_stock 49.95 AUD 39.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Cola Crush 32880069378148 4836907909220creaburn30serves300ggrapesplash Maxine's Crea BURN - 30 Serves (300g) - Grape Splash Creatine is the most effective and widely researched supplement available for improving body composition and performance. Why?? Because it works amazingly well! Every athlete, weekend warrior, and gym goer should be using it. What does Creatine do? Put simply, Creatine increases your ability to train or compete har's New in_stock 49.95 AUD 39.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Workout Performance > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay30 Serves (300g) Grape Splash 4864133693540 vibrantMaxine's VIBRANT - 35 Serves (100 Capsules) Maxine’s VIBRANT is a female hormone balance formula designed to promote healthy estrogen levels whilst supporting vitality, mood and energy. This all natural combination of DIM (Diindolylmethane), Panax Ginseng and Maca Root will help keep you happy, healthy and vibrant every day! Maxine's New in_stock49.95 AUD 39.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Workout Performance 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4836907974756 acetyl-l-carnitine-with-matchaMaxine's Acetyl-L Carnitine With Matcha - 50 Serves (100 Capsules) Maxine’s ACETYL-L CARNITINE is our all natural fat burning capsule with the added benefit of Matcha Green Tea. Take Maxine’s ACETYL-L CARNITINE daily to accelerate fat burning, improve mental clarity and help you feel vital, active and focussed. Maxine's New out_of_stock49.95 AUD 34.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Fat Burners 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4836908007524 cla-conjugated-linoleic-acidMaxine's CLA - Conjugated Linoleic Acid - 50 Serves (100 Capsules) Maxine’s CLA is pure Conjugated Linoleic Acid, a proven fat metaboliser, in an effectively dosed serving. Take Maxine’s CLA daily to accelerate fat burning, improve metabolism and help you feel vital, active and focused. Maxine's New in_stock39.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Fat Burners 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 32943463465060 4820381007972beginnerburnpackchocfudgebrowniechocolatemousse Maxine's Beginner Burn Pack - Choc Fudge Brownie - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse 32943463596132 4820381007972beginnerburnpackchocfudgebrownievanilladream Maxine's Beginner Burn Pack - Choc Fudge Brownie - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream 32943463727204 4820381007972beginnerburnpackvanillaicecreamchocolatemousse Maxine's Beginner Burn Pack - Vanilla Ice Cream - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse 32943463858276 4820381007972beginnerburnpackvanillaicecreamvanilladream Maxine's Beginner Burn Pack - Vanilla Ice Cream - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream 32943463989348 4820381007972beginnerburnpackchocolatehoneycombchocolatemousse Maxine's Beginner Burn Pack - Chocolate Honeycomb - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse 32943464120420 4820381007972beginnerburnpackchocolatehoneycombvanilladream Maxine's Beginner Burn Pack - Chocolate Honeycomb - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream 32943464251492 4820381007972beginnerburnpacksaltedcaramelchocolatemousse Maxine's Beginner Burn Pack - Salted Caramel - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse 32943464382564 4820381007972beginnerburnpacksaltedcaramelvanilladream Maxine's Beginner Burn Pack - Salted Caramel - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream 32943464513636 4820381007972beginnerburnpackberrycheesecakechocolatemousse Maxine's Beginner Burn Pack - Berry Cheesecake - Chocolate Mousse Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse 32943464644708 4820381007972beginnerburnpackberrycheesecakevanilladream Maxine's Beginner Burn Pack - Berry Cheesecake - Vanilla Dream Exclusive value pack includes: ✓ 500g Maxine’s Burn ✓ 500g Maxine’s Night ✓ 3 Maxine’s Burn bars (Free) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 70.75 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream 32943516123236 4820382285924intermediateburnpackchocfudgebrowniechocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Choc Fudge Brownie - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Fruity Frost 32943516156004 4820382285924intermediateburnpackchocfudgebrowniechocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Choc Fudge Brownie - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Going Grape 32943516188772 4820382285924intermediateburnpackchocfudgebrownievanilladreamfruityfrost Maxine's Intermediate Burn Pack - Choc Fudge Brownie - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Fruity Frost 32943516221540 4820382285924intermediateburnpackchocfudgebrownievanilladreamgoinggrape Maxine's Intermediate Burn Pack - Choc Fudge Brownie - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Going Grape 32943516254308 4820382285924intermediateburnpackvanillaicecreamchocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Vanilla Ice Cream - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Fruity Frost 32943516287076 4820382285924intermediateburnpackvanillaicecreamchocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Vanilla Ice Cream - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Going Grape 32943516319844 4820382285924intermediateburnpackvanillaicecreamvanilladreamfruityfrost Maxine's Intermediate Burn Pack - Vanilla Ice Cream - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Fruity Frost 32943516352612 4820382285924intermediateburnpackvanillaicecreamvanilladreamgoinggrape Maxine's Intermediate Burn Pack - Vanilla Ice Cream - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Going Grape 32943516385380 4820382285924intermediateburnpackchocolatehoneycombchocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Chocolate Honeycomb - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse Fruity Frost 32943516418148 4820382285924intermediateburnpackchocolatehoneycombchocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Chocolate Honeycomb - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Chocolate Mousse Going Grape 32943516450916 4820382285924intermediateburnpackchocolatehoneycombvanilladreamfruityfrost Maxine's Intermediate Burn Pack - Chocolate Honeycomb - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream Fruity Frost 32943516483684 4820382285924intermediateburnpackchocolatehoneycombvanilladreamgoinggrape Maxine's Intermediate Burn Pack - Chocolate Honeycomb - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate Honeycomb Vanilla Dream Going Grape 32943516516452 4820382285924intermediateburnpacksaltedcaramelchocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Salted Caramel - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse Fruity Frost 32943516549220 4820382285924intermediateburnpacksaltedcaramelchocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Salted Caramel - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Chocolate Mousse Going Grape 32943516581988 4820382285924intermediateburnpacksaltedcaramelvanilladreamfruityfrost Maxine's Intermediate Burn Pack - Salted Caramel - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream Fruity Frost 32943516614756 4820382285924intermediateburnpacksaltedcaramelvanilladreamgoinggrape Maxine's Intermediate Burn Pack - Salted Caramel - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Salted Caramel Vanilla Dream Going Grape 32943516647524 4820382285924intermediateburnpackberrycheesecakechocolatemoussefruityfrost Maxine's Intermediate Burn Pack - Berry Cheesecake - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse Fruity Frost 32943516680292 4820382285924intermediateburnpackberrycheesecakechocolatemoussegoinggrape Maxine's Intermediate Burn Pack - Berry Cheesecake - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Chocolate Mousse Going Grape 32943516713060 4820382285924intermediateburnpackberrycheesecakevanilladreamfruityfrost Maxine's Intermediate Burn Pack - Berry Cheesecake - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream Fruity Frost 32943516745828 4820382285924intermediateburnpackberrycheesecakevanilladreamgoinggrape Maxine's Intermediate Burn Pack - Berry Cheesecake - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ Maxine’s Intermediate: $159.95 ✓ 1.25 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ 300g SIP’N Burn (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 186.80 AUD 159.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Berry Cheesecake Vanilla Dream Going Grape 32943555477604 4820382351460advancedburnpackchocfudgebrowniechocolatemoussefruityfrost Maxine's Advanced Burn Pack - Choc Fudge Brownie - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 289.95 AUD 245.00 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Fruity Frost 32943555510372 4820382351460advancedburnpackchocfudgebrowniechocolatemoussegoinggrape Maxine's Advanced Burn Pack - Choc Fudge Brownie - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 289.95 AUD 245.00 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Chocolate Mousse Going Grape 32943555543140 4820382351460advancedburnpackchocfudgebrownievanilladreamfruityfrost Maxine's Advanced Burn Pack - Choc Fudge Brownie - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 289.95 AUD 245.00 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Fruity Frost 32943555575908 4820382351460advancedburnpackchocfudgebrownievanilladreamgoinggrape Maxine's Advanced Burn Pack - Choc Fudge Brownie - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 289.95 AUD 245.00 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Choc Fudge Brownie Vanilla Dream Going Grape 32943555608676 4820382351460advancedburnpackvanillaicecreamchocolatemoussefruityfrost Maxine's Advanced Burn Pack - Vanilla Ice Cream - Chocolate Mousse - Fruity Frost Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 289.95 AUD 245.00 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Fruity Frost 32943555641444 4820382351460advancedburnpackvanillaicecreamchocolatemoussegoinggrape Maxine's Advanced Burn Pack - Vanilla Ice Cream - Chocolate Mousse - Going Grape Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 289.95 AUD 245.00 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Chocolate Mousse Going Grape 32943555674212 4820382351460advancedburnpackvanillaicecreamvanilladreamfruityfrost Maxine's Advanced Burn Pack - Vanilla Ice Cream - Vanilla Dream - Fruity Frost Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 289.95 AUD 245.00 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Fruity Frost 32943555706980 4820382351460advancedburnpackvanillaicecreamvanilladreamgoinggrape Maxine's Advanced Burn Pack - Vanilla Ice Cream - Vanilla Dream - Going Grape Exclusive value pack includes: ✓ 2.2 KG Maxine’s Burn ✓ 1 KG Maxine’s Night ✓ 1 Box Maxine’s Burn Bars ✓ XT BURN ✓ 300g SIP’N Burn (Free Gift) ✓ CLA Caps (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 289.95 AUD 245.00 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Vanilla Ice Cream Vanilla Dream Going Grape 32606896750692 4823374692452veganstarterpack36serves908gnaturalchocolate36serves908gnaturalchocola Maxine's Vegan Starter Pack - 36 Serves (908g) - Natural Chocolate - 36 Serves (908g) - Natural Chocolate - Maxine's VIBRANT Capsules Exclusive value pack includes: ✓ 900g Maxine’s Plant Protein ✓ 900g Maxine’s Plant Protein ✓ CLA Caps (Free Gift). Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 129.95 AUD 119.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) - Natural Chocolate 36 Serves (908g) - Natural Chocolate Maxine's VIBRANT Capsules 32606896783460 4823374692452veganstarterpack36serves908gnaturalchocolate36serves908gvanillabeanmax Maxine's Vegan Starter Pack - 36 Serves (908g) - Natural Chocolate - 36 Serves (908g) - Vanilla Bean - Maxine's VIBRANT Capsules Exclusive value pack includes: ✓ 900g Maxine’s Plant Protein ✓ 900g Maxine’s Plant Protein ✓ CLA Caps (Free Gift). Order today for a discounted price and guaranteed fast shipping!'s New in_stock 129.95 AUD 119.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) - Natural Chocolate 36 Serves (908g) - Vanilla Bean Maxine's VIBRANT Capsules 32606896816228 4823374692452veganstarterpack36serves908gvanillabean36serves908gnaturalchocolatemax Maxine's Vegan Starter Pack - 36 Serves (908g) - Vanilla Bean - 36 Serves (908g) - Natural Chocolate - Maxine's VIBRANT Capsules Exclusive value pack includes: ✓ 900g Maxine’s Plant Protein ✓ 900g Maxine’s Plant Protein ✓ CLA Caps (Free Gift). Order today for a discounted price and guaranteed fast shipping!'s New in_stock 129.95 AUD 119.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) - Vanilla Bean 36 Serves (908g) - Natural Chocolate Maxine's VIBRANT Capsules 32606896848996 4823374692452veganstarterpack36serves908gvanillabean36serves908gvanillabeanmaxinesv Maxine's Vegan Starter Pack - 36 Serves (908g) - Vanilla Bean - 36 Serves (908g) - Vanilla Bean - Maxine's VIBRANT Capsules Exclusive value pack includes: ✓ 900g Maxine’s Plant Protein ✓ 900g Maxine’s Plant Protein ✓ CLA Caps (Free Gift). Order today for a discounted price and guaranteed fast shipping!'s New in_stock 129.95 AUD 119.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) - Vanilla Bean 36 Serves (908g) - Vanilla Bean Maxine's VIBRANT Capsules 32880586948708 4836964237412advancedveganpack36serves908gnaturalchocolate36serves908gnaturalchocol Maxine's Advanced Vegan Pack - 36 Serves (908g) Natural Chocolate - 36 Serves (908g) Natural Chocolate Exclusive value pack includes: ✓ 2x 908g Maxine’s Plant Protein ✓ 300g SIP’N Burn ✓ 300g Crea Burn ✓ Maxine’s Acetyl-L Carnitine With Matcha (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 249.95 AUD 199.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) Natural Chocolate 36 Serves (908g) Natural Chocolate 32880586981476 4836964237412advancedveganpack36serves908gnaturalchocolate36serves908gvanillabean Maxine's Advanced Vegan Pack - 36 Serves (908g) Natural Chocolate - 36 Serves (908g) Vanilla Bean Exclusive value pack includes: ✓ 2x 908g Maxine’s Plant Protein ✓ 300g SIP’N Burn ✓ 300g Crea Burn ✓ Maxine’s Acetyl-L Carnitine With Matcha (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 249.95 AUD 199.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) Natural Chocolate 36 Serves (908g) Vanilla Bean 32880587014244 4836964237412advancedveganpack36serves908gvanillabean36serves908gnaturalchocolate Maxine's Advanced Vegan Pack - 36 Serves (908g) Vanilla Bean - 36 Serves (908g) Natural Chocolate Exclusive value pack includes: ✓ 2x 908g Maxine’s Plant Protein ✓ 300g SIP’N Burn ✓ 300g Crea Burn ✓ Maxine’s Acetyl-L Carnitine With Matcha (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 249.95 AUD 199.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) Vanilla Bean 36 Serves (908g) Natural Chocolate 32880587047012 4836964237412advancedveganpack36serves908gvanillabean36serves908gvanillabean Maxine's Advanced Vegan Pack - 36 Serves (908g) Vanilla Bean - 36 Serves (908g) Vanilla Bean Exclusive value pack includes: ✓ 2x 908g Maxine’s Plant Protein ✓ 300g SIP’N Burn ✓ 300g Crea Burn ✓ Maxine’s Acetyl-L Carnitine With Matcha (Free Gift) ✓ Maxine’s Shaker (Free Gift) Order today for a discounted price and guaranteed fast shipping!'s New in_stock 249.95 AUD 199.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 36 Serves (908g) Vanilla Bean 36 Serves (908g) Vanilla Bean 32880246030436 4836918886500twinpackburnprotein20serves500gchocfudgebrowniechocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Choc Fudge Brownie 32880246063204 4836918886500twinpackburnprotein20serves500gchocfudgebrownieberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Berry Cheesecake 32880246095972 4836918886500twinpackburnprotein20serves500gchocfudgebrownievanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Vanilla Ice Cream 32880246128740 4836918886500twinpackburnprotein20serves500gchocfudgebrowniechochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Choc Honeycomb 32880246161508 4836918886500twinpackburnprotein20serves500gchocfudgebrowniesaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Fudge Brownie - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Fudge Brownie Salted Caramel 32880246194276 4836918886500twinpackburnprotein20serves500gberrycheesecakechocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Choc Fudge Brownie 32880246227044 4836918886500twinpackburnprotein20serves500gberrycheesecakeberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Berry Cheesecake 32880246259812 4836918886500twinpackburnprotein20serves500gberrycheesecakevanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Vanilla Ice Cream 32880246292580 4836918886500twinpackburnprotein20serves500gberrycheesecakechochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Choc Honeycomb 32880246325348 4836918886500twinpackburnprotein20serves500gberrycheesecakesaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Berry Cheesecake - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Berry Cheesecake Salted Caramel 32880246358116 4836918886500twinpackburnprotein20serves500gvanillaicecreamchocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Choc Fudge Brownie 32880246390884 4836918886500twinpackburnprotein20serves500gvanillaicecreamberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Berry Cheesecake 32880246423652 4836918886500twinpackburnprotein20serves500gvanillaicecreamvanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Vanilla Ice Cream 32880246456420 4836918886500twinpackburnprotein20serves500gvanillaicecreamchochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Choc Honeycomb 32880246489188 4836918886500twinpackburnprotein20serves500gvanillaicecreamsaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Vanilla Ice Cream - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Ice Cream Salted Caramel 32880246521956 4836918886500twinpackburnprotein20serves500gchochoneycombchocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Choc Fudge Brownie 32880246554724 4836918886500twinpackburnprotein20serves500gchochoneycombberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Berry Cheesecake 32880246587492 4836918886500twinpackburnprotein20serves500gchochoneycombvanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Vanilla Ice Cream 32880246620260 4836918886500twinpackburnprotein20serves500gchochoneycombchochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Choc Honeycomb 32880246653028 4836918886500twinpackburnprotein20serves500gchochoneycombsaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Choc Honeycomb - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Choc Honeycomb Salted Caramel 32880246685796 4836918886500twinpackburnprotein20serves500gsaltedcaramelchocfudgebrownie Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Choc Fudge Brownie 32880246718564 4836918886500twinpackburnprotein20serves500gsaltedcaramelberrycheesecake Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Berry Cheesecake 32880246751332 4836918886500twinpackburnprotein20serves500gsaltedcaramelvanillaicecream Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Vanilla Ice Cream 32880246784100 4836918886500twinpackburnprotein20serves500gsaltedcaramelchochoneycomb Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Choc Honeycomb 32880246816868 4836918886500twinpackburnprotein20serves500gsaltedcaramelsaltedcaramel Twin Pack: Maxine's Burn Protein - 20 Serves (500g) - Salted Caramel - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 69.90 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Salted Caramel Salted Caramel 32880246849636 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniechocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Choc Fudge Brownie 32880246882404 4836918886500twinpackburnprotein50serves125kgchocfudgebrownieberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Berry Cheesecake 32880246915172 4836918886500twinpackburnprotein50serves125kgchocfudgebrownievanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Vanilla Ice Cream 32880246947940 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniechochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Choc Honeycomb 32880246980708 4836918886500twinpackburnprotein50serves125kgchocfudgebrowniesaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Fudge Brownie - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Fudge Brownie Salted Caramel 32880247013476 4836918886500twinpackburnprotein50serves125kgberrycheesecakechocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Choc Fudge Brownie 32880247046244 4836918886500twinpackburnprotein50serves125kgberrycheesecakeberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Berry Cheesecake 32880247079012 4836918886500twinpackburnprotein50serves125kgberrycheesecakevanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Vanilla Ice Cream 32880247111780 4836918886500twinpackburnprotein50serves125kgberrycheesecakechochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Choc Honeycomb 32880247144548 4836918886500twinpackburnprotein50serves125kgberrycheesecakesaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Berry Cheesecake - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Berry Cheesecake Salted Caramel 32880247177316 4836918886500twinpackburnprotein50serves125kgvanillaicecreamchocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Choc Fudge Brownie 32880247210084 4836918886500twinpackburnprotein50serves125kgvanillaicecreamberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Berry Cheesecake 32880247242852 4836918886500twinpackburnprotein50serves125kgvanillaicecreamvanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Vanilla Ice Cream 32880247275620 4836918886500twinpackburnprotein50serves125kgvanillaicecreamchochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Choc Honeycomb 32880247308388 4836918886500twinpackburnprotein50serves125kgvanillaicecreamsaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Vanilla Ice Cream - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Vanilla Ice Cream Salted Caramel 32880247341156 4836918886500twinpackburnprotein50serves125kgchochoneycombchocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Choc Fudge Brownie 32880247373924 4836918886500twinpackburnprotein50serves125kgchochoneycombberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Berry Cheesecake 32880247406692 4836918886500twinpackburnprotein50serves125kgchochoneycombvanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Vanilla Ice Cream 32880247439460 4836918886500twinpackburnprotein50serves125kgchochoneycombchochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Choc Honeycomb 32880247472228 4836918886500twinpackburnprotein50serves125kgchochoneycombsaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Choc Honeycomb - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Choc Honeycomb Salted Caramel 32880247504996 4836918886500twinpackburnprotein50serves125kgsaltedcaramelchocfudgebrownie Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Choc Fudge Brownie Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Choc Fudge Brownie 32880247537764 4836918886500twinpackburnprotein50serves125kgsaltedcaramelberrycheesecake Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Berry Cheesecake Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Berry Cheesecake 32880247570532 4836918886500twinpackburnprotein50serves125kgsaltedcaramelvanillaicecream Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Vanilla Ice Cream Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Vanilla Ice Cream 32880247603300 4836918886500twinpackburnprotein50serves125kgsaltedcaramelchochoneycomb Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Choc Honeycomb Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Choc Honeycomb 32880247636068 4836918886500twinpackburnprotein50serves125kgsaltedcaramelsaltedcaramel Twin Pack: Maxine's Burn Protein - 50 Serves (1.25kg) - Salted Caramel - Salted Caramel Twin Pack: Maxine's Burn Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay50 Serves (1.25kg) Salted Caramel Salted Caramel 32880256090212 4836918460516twinpacknightprotein20serves500gchocolatemoussechocolatemousse Twin Pack: Maxine's Night Protein - 20 Serves (500g) - Chocolate Mousse - Chocolate Mousse Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 79.95 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse Chocolate Mousse 32880256122980 4836918460516twinpacknightprotein20serves500gchocolatemoussevanilladream Twin Pack: Maxine's Night Protein - 20 Serves (500g) - Chocolate Mousse - Vanilla Dream Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 79.95 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Chocolate Mousse Vanilla Dream 32880256155748 4836918460516twinpacknightprotein20serves500gvanilladreamchocolatemousse Twin Pack: Maxine's Night Protein - 20 Serves (500g) - Vanilla Dream - Chocolate Mousse Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New out_of_stock 79.95 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream Chocolate Mousse 32880256188516 4836918460516twinpacknightprotein20serves500gvanilladreamvanilladream Twin Pack: Maxine's Night Protein - 20 Serves (500g) - Vanilla Dream - Vanilla Dream Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay20 Serves (500g) Vanilla Dream Vanilla Dream 32880256221284 4836918460516twinpacknightprotein40serves1kgchocolatemoussechocolatemousse Twin Pack: Maxine's Night Protein - 40 Serves (1kg) - Chocolate Mousse - Chocolate Mousse Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 89.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse Chocolate Mousse 32880256254052 4836918460516twinpacknightprotein40serves1kgchocolatemoussevanilladream Twin Pack: Maxine's Night Protein - 40 Serves (1kg) - Chocolate Mousse - Vanilla Dream Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 89.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Chocolate Mousse Vanilla Dream 32880256286820 4836918460516twinpacknightprotein40serves1kgvanilladreamchocolatemousse Twin Pack: Maxine's Night Protein - 40 Serves (1kg) - Vanilla Dream - Chocolate Mousse Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 89.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream Chocolate Mousse 32880256319588 4836918460516twinpacknightprotein40serves1kgvanilladreamvanilladream Twin Pack: Maxine's Night Protein - 40 Serves (1kg) - Vanilla Dream - Vanilla Dream Twin Pack: Maxine's Night Protein Powder. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 119.95 AUD 89.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay40 Serves (1kg) Vanilla Dream Vanilla Dream 32880265527396 4836919640164twinpackplantprotein16serves400gnaturalchocolatenaturalchocolate Twin Pack: Maxine's Plant Protein - 16 Serves (400g) - Natural Chocolate - Natural Chocolate Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 62.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate Natural Chocolate 32880265560164 4836919640164twinpackplantprotein16serves400gnaturalchocolatevanillabean Twin Pack: Maxine's Plant Protein - 16 Serves (400g) - Natural Chocolate - Vanilla Bean Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 62.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Natural Chocolate Vanilla Bean 32880265592932 4836919640164twinpackplantprotein16serves400gvanillabeannaturalchocolate Twin Pack: Maxine's Plant Protein - 16 Serves (400g) - Vanilla Bean - Natural Chocolate Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 62.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean Natural Chocolate 32880265625700 4836919640164twinpackplantprotein16serves400gvanillabeanvanillabean Twin Pack: Maxine's Plant Protein - 16 Serves (400g) - Vanilla Bean - Vanilla Bean Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 79.95 AUD 62.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (400g) Vanilla Bean Vanilla Bean 32880265658468 4836919640164twinpackplantprotein36serves908gnaturalchocolatenaturalchocolate Twin Pack: Maxine's Plant Protein - 36 Serves (908g) - Natural Chocolate - Natural Chocolate Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate Natural Chocolate 32880265691236 4836919640164twinpackplantprotein36serves908gnaturalchocolatevanillabean Twin Pack: Maxine's Plant Protein - 36 Serves (908g) - Natural Chocolate - Vanilla Bean Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Natural Chocolate Vanilla Bean 32880265724004 4836919640164twinpackplantprotein36serves908gvanillabeannaturalchocolate Twin Pack: Maxine's Plant Protein - 36 Serves (908g) - Vanilla Bean - Natural Chocolate Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean Natural Chocolate 32880265756772 4836919640164twinpackplantprotein36serves908gvanillabeanvanillabean Twin Pack: Maxine's Plant Protein - 36 Serves (908g) - Vanilla Bean - Vanilla Bean Twin Pack: Maxine's Plant Protein. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 139.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay36 Serves (908g) Vanilla Bean Vanilla Bean 4836920557668 twin-pack-burn-barsTwin Pack: Maxine's Burn Bars - Double Choc Fudge Twin Pack: Maxine's Burn Bars. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock7.95 AUD 5.29 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Double Choc Fudge 4836920590436 twin-pack-burn-cookiesTwin Pack: Maxine's Burn Cookies - Chocolate Twin Pack: Maxine's Burn Cookies. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New in_stock7.95 AUD 5.29 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Chocolate 32880269688932 4836919902308twinpacksipnburnfruityfrostfruityfrost Twin Pack: Maxine's Sip N' Burn - Fruity Frost - Fruity Frost Twin Pack: Maxine's Sip N' Burn. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Fruity Frost Fruity Frost 32880269721700 4836919902308twinpacksipnburnfruityfrostgoinggrape Twin Pack: Maxine's Sip N' Burn - Fruity Frost - Going Grape Twin Pack: Maxine's Sip N' Burn. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Fruity Frost Going Grape 32880269754468 4836919902308twinpacksipnburngoinggrapefruityfrost Twin Pack: Maxine's Sip N' Burn - Going Grape - Fruity Frost Twin Pack: Maxine's Sip N' Burn. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Going Grape Fruity Frost 32880269787236 4836919902308twinpacksipnburngoinggrapegoinggrape Twin Pack: Maxine's Sip N' Burn - Going Grape - Going Grape Twin Pack: Maxine's Sip N' Burn. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Going Grape Going Grape 32880274374756 4836920328292twinpackcreaburncolacrushcolacrush Twin Pack: Maxine's Crea BURN - Cola Crush - Cola Crush Twin Pack: Maxine's Crea BURN. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cola Crush Cola Crush 32880274407524 4836920328292twinpackcreaburncolacrushgrapesplash Twin Pack: Maxine's Crea BURN - Cola Crush - Grape Splash Twin Pack: Maxine's Crea BURN. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Cola Crush Grape Splash 32880274440292 4836920328292twinpackcreaburngrapesplashcolacrush Twin Pack: Maxine's Crea BURN - Grape Splash - Cola Crush Twin Pack: Maxine's Crea BURN. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Grape Splash Cola Crush 32880274473060 4836920328292twinpackcreaburngrapesplashgrapesplash Twin Pack: Maxine's Crea BURN - Grape Splash - Grape Splash Twin Pack: Maxine's Crea BURN. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping!'s New in_stock 99.95 AUD 71.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Grape Splash Grape Splash 4836920361060 twin-pack-acetyl-l-carnitine-capsulesTwin Pack: Maxine's Acetyl-L Carnitine Capsules Twin Pack: Maxine's Acetyl-L Carnitine With Matcha. Shop Online at Maxine's Protein Australia™ - Premium Proteins & Fat Burning Supplements. Order today for a discounted price and guaranteed fast shipping! Maxine's New out_of_stock79.90 AUD 62.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4836920754276 twin-pack-cla-capsulesTwin Pack: Maxine's CLA Capsules Maxine's New in_stock79.95 AUD 53.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4816552198244 maxines-premium-shakerMaxine's Premium Shaker The Maxine's My-Bottle Shaker Bottle is the most advanced and health friendly shaker bottle on the market today helping you to produce the smoothest and most replenishing drink with minimal effort. The secure No-Spill lockable lid system ensures no spills whilst the wide pop top 'flip cap' offers an easy to use design Maxine's New in_stock19.95 AUD 14.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 4816000516196 pink-training-singletMaxine's Pink Training Singlet - XS Made from 100% Australian cotton for breathability and comfort, this easy wear, easy care tank with your favorite pair of tights is suitable for a range of workouts such as Training outdoors or in the Gym. Logo: Women Who Lift - Maxine's Maxine's New in_stock34.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayXS 4816552132708 black-training-singletMaxine's Black Training Singlet - XS Made from 100% Australian cotton for breathability and comfort, this easy wear, easy care tank with your favorite pair of tights is suitable for a range of workouts such as Training outdoors or in the Gym. Logo: Women Who Lift - Maxine's Maxine's New in_stock34.95 AUD 29.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPayXS 4816552362084 maxines-training-t-shirtMaxine's Training T-Shirt - 6 The MAXINE'S Logo T-Shirt delivers lasting comfort with a soft cotton fabric. ✓ Rib crew neck with interior taping. ✓ MAXINE'S chest logo. ✓ Fabric: 100% cotton. ✓ Machine wash. Maxine's New in_stock29.95 AUD 12.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay6 39295360729188 6539906187364burncustard16serves500gcreamyvanillagoodness Maxine's BURN Custard - 16 Serves (500g) - Creamy Vanilla Goodness's New in_stock 69.95 AUD 32.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Creamy Vanilla Goodness 39295360893028 6539906187364burncustard16serves500gwhippedchocolatedecadence Maxine's BURN Custard - 16 Serves (500g) - Whipped Chocolate Decadence's New in_stock 69.95 AUD 32.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Whipped Chocolate Decadence 39258441187428 6539906187364burncustard33serves1kgcreamyvanillagoodness Maxine's BURN Custard - 33 Serves (1kg) - Creamy Vanilla Goodness's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Creamy Vanilla Goodness 39258441154660 6539906187364burncustard33serves1kgwhippedchocolatedecadence Maxine's BURN Custard - 33 Serves (1kg) - Whipped Chocolate Decadence's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Protein Powders > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Whipped Chocolate Decadence 39265275281508 6542142636132twinpackburncustard16serves500gcreamyvanillagoodnesscreamyvanillagoodn Twin Pack: Maxine's BURN Custard - 16 Serves (500g) - Creamy Vanilla Goodness - Creamy Vanilla Goodness's New out_of_stock 65.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Creamy Vanilla Goodness Creamy Vanilla Goodness 39265275314276 6542142636132twinpackburncustard16serves500gcreamyvanillagoodnesswhippedchocolatede Twin Pack: Maxine's BURN Custard - 16 Serves (500g) - Creamy Vanilla Goodness - Whipped Chocolate Decadence's New out_of_stock 65.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Creamy Vanilla Goodness Whipped Chocolate Decadence 39265275347044 6542142636132twinpackburncustard16serves500gwhippedchocolatedecadencecreamyvanillag Twin Pack: Maxine's BURN Custard - 16 Serves (500g) - Whipped Chocolate Decadence - Creamy Vanilla Goodness's New out_of_stock 65.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Whipped Chocolate Decadence Creamy Vanilla Goodness 39265275379812 6542142636132twinpackburncustard16serves500gwhippedchocolatedecadencewhippedchocola Twin Pack: Maxine's BURN Custard - 16 Serves (500g) - Whipped Chocolate Decadence - Whipped Chocolate Decadence's New in_stock 65.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay16 Serves (500g) Whipped Chocolate Decadence Whipped Chocolate Decadence 39265275412580 6542142636132twinpackburncustard33serves1kgcreamyvanillagoodnesscreamyvanillagoodne Twin Pack: Maxine's BURN Custard - 33 Serves (1kg) - Creamy Vanilla Goodness - Creamy Vanilla Goodness's New in_stock 119.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Creamy Vanilla Goodness Creamy Vanilla Goodness 39265275445348 6542142636132twinpackburncustard33serves1kgcreamyvanillagoodnesswhippedchocolatedec Twin Pack: Maxine's BURN Custard - 33 Serves (1kg) - Creamy Vanilla Goodness - Whipped Chocolate Decadence's New in_stock 119.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Creamy Vanilla Goodness Whipped Chocolate Decadence 39265275478116 6542142636132twinpackburncustard33serves1kgwhippedchocolatedecadencecreamyvanillago Twin Pack: Maxine's BURN Custard - 33 Serves (1kg) - Whipped Chocolate Decadence - Creamy Vanilla Goodness's New in_stock 119.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Whipped Chocolate Decadence Creamy Vanilla Goodness 39265275510884 6542142636132twinpackburncustard33serves1kgwhippedchocolatedecadencewhippedchocolat Twin Pack: Maxine's BURN Custard - 33 Serves (1kg) - Whipped Chocolate Decadence - Whipped Chocolate Decadence's New in_stock 119.95 AUD 107.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 0 AUD Twin Packs > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay33 Serves (1kg) Whipped Chocolate Decadence Whipped Chocolate Decadence 6546036850788 maxines-workout-bottleMaxine's Workout Bottle Maxine's New in_stock24.95 AUD 19.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Apparel & Accessories 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay 39295397724260 6552463048804burncustardfreegiftscreamyvanillagoodnesschoccaramelcrunchmaxinesgymto Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Choc Caramel Crunch - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Choc Caramel Crunch Maxine's Gym Towel 39295397757028 6552463048804burncustardfreegiftscreamyvanillagoodnessdoublechocfudgemaxinesgymtowe Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Double Choc Fudge - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Double Choc Fudge Maxine's Gym Towel 39295397789796 6552463048804burncustardfreegiftscreamyvanillagoodnesscookiescreammaxinesgymtowel Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Cookies & Cream - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Cookies & Cream Maxine's Gym Towel 39295397822564 6552463048804burncustardfreegiftscreamyvanillagoodnesschocmochamaxinesgymtowel Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Choc Mocha - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Choc Mocha Maxine's Gym Towel 39295397855332 6552463048804burncustardfreegiftscreamyvanillagoodnesschocmintfudgemaxinesgymtowel Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Choc Mint Fudge - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Choc Mint Fudge Maxine's Gym Towel 39295397888100 6552463048804burncustardfreegiftscreamyvanillagoodnesscoconutdreammaxinesgymtowel Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Coconut Dream - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Coconut Dream Maxine's Gym Towel 39295397920868 6552463048804burncustardfreegiftscreamyvanillagoodnesshazelnutheavenmaxinesgymtowel Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Hazelnut Heaven - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Hazelnut Heaven Maxine's Gym Towel 39295397953636 6552463048804burncustardfreegiftscreamyvanillagoodnessredvelvetcupcakemaxinesgymtow Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Red Velvet Cupcake - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Red Velvet Cupcake Maxine's Gym Towel 39295397986404 6552463048804burncustardfreegiftscreamyvanillagoodnesswhitechocraspberrymaxinesgymt Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - White Choc Raspberry - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness White Choc Raspberry Maxine's Gym Towel 39295398019172 6552463048804burncustardfreegiftscreamyvanillagoodnessmangococonutcreammaxinesgymto Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Mango Coconut Cream - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Mango Coconut Cream Maxine's Gym Towel 39295398051940 6552463048804burncustardfreegiftscreamyvanillagoodnessberrydelightmaxinesgymtowel Maxine's BURN Custard + Free Gifts - Creamy Vanilla Goodness - Berry Delight - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Creamy Vanilla Goodness Berry Delight Maxine's Gym Towel 39295398084708 6552463048804burncustardfreegiftswhippedchocolatedecadencechoccaramelcrunchmaxinesg Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Choc Caramel Crunch - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Choc Caramel Crunch Maxine's Gym Towel 39295398117476 6552463048804burncustardfreegiftswhippedchocolatedecadencedoublechocfudgemaxinesgym Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Double Choc Fudge - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Double Choc Fudge Maxine's Gym Towel 39295398150244 6552463048804burncustardfreegiftswhippedchocolatedecadencecookiescreammaxinesgymtow Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Cookies & Cream - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Cookies & Cream Maxine's Gym Towel 39295398183012 6552463048804burncustardfreegiftswhippedchocolatedecadencechocmochamaxinesgymtowel Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Choc Mocha - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Choc Mocha Maxine's Gym Towel 39295398215780 6552463048804burncustardfreegiftswhippedchocolatedecadencechocmintfudgemaxinesgymto Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Choc Mint Fudge - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Choc Mint Fudge Maxine's Gym Towel 39295398248548 6552463048804burncustardfreegiftswhippedchocolatedecadencecoconutdreammaxinesgymtow Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Coconut Dream - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Coconut Dream Maxine's Gym Towel 39295398281316 6552463048804burncustardfreegiftswhippedchocolatedecadencehazelnutheavenmaxinesgymt Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Hazelnut Heaven - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Hazelnut Heaven Maxine's Gym Towel 39295398314084 6552463048804burncustardfreegiftswhippedchocolatedecadenceredvelvetcupcakemaxinesgy Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Red Velvet Cupcake - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Red Velvet Cupcake Maxine's Gym Towel 39295398346852 6552463048804burncustardfreegiftswhippedchocolatedecadencewhitechocraspberrymaxines Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - White Choc Raspberry - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence White Choc Raspberry Maxine's Gym Towel 39295398379620 6552463048804burncustardfreegiftswhippedchocolatedecadencemangococonutcreammaxinesg Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Mango Coconut Cream - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Mango Coconut Cream Maxine's Gym Towel 39295398412388 6552463048804burncustardfreegiftswhippedchocolatedecadenceberrydelightmaxinesgymtow Maxine's BURN Custard + Free Gifts - Whipped Chocolate Decadence - Berry Delight - Maxine's Gym Towel's New in_stock 69.95 AUD 59.95 AUD 2021-04-17T17:24:34+1000/2021-05-17T17:24:34+1000 AU Standard 9.95 AUD Packs & Bundles > Variants 1 Visa MasterCard AmericanExpress Discover We also accept Paypal, Apple Pay, Google Pay and AfterPay Whipped Chocolate Decadence Berry Delight Maxine's Gym Towel